KEGG   Tribolium castaneum (red flour beetle): 659272Help
Entry
659272            CDS       T01046                                 

Definition
similar to CG10467-PA
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tca00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tca00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG1=X
AA seq 366 aa AA seqDB search
MVKLTQDQFDLYTYKNTGKSVSVRSFTWTNQSHVSVQVITYGATITSMKVPDKNGAIKDV
VGGGSTIAEYQKAEVYFGATVGRVANRIGNGQFRLFDQIVNVSKNLGKHQLHGGFVGFDK
VIWEYYVSGNKVIMSYHSADGEEGYPGDVVVHATFELTENNEFLVEYKATTTKPTFVNLT
NHSYFNLAGHDAGASELYKHVVCINADQITEVDNDSIPTGKLLPVANTVFDLQVPKVLGD
VITKVPNSDGFDHNFCINKGPEQGTTFIARVYHPESGRMLEVYSNQPGVQFYTSNFFPEN
PKTYKGDKTKLATLSGKGASYYKHGALCLETQNWPDAPNHDNFPKSILVPGETYHHNVAY
KFSVKN
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggttaaactaacgcaagaccagttcgacttgtacacctacaaaaacaccggaaagtcc
gtctctgtccgcagttttacttggacaaaccagagccacgtctctgtgcaagtcattact
tatggggccaccatcacctccatgaaagtccccgacaagaacggggctatcaaggacgtc
gtgggcggcggcagcacgattgccgagtaccaaaaggccgaggtttatttcggcgcaaca
gtggggcgcgtcgctaacaggattggaaacggtcagttcaggctttttgaccaaattgtc
aatgttagcaaaaatctgggcaagcaccagttgcacggcggcttcgtcgggtttgataaa
gtcatttgggagtattacgttagtggcaacaaggtaataatgagttaccactcggccgat
ggtgaggagggttaccctggcgatgtggtggtccatgccacttttgagctaacagaaaac
aatgaatttctggtcgagtataaggccaccacgaccaaaccgacctttgtcaatttaaca
aaccattcatacttcaatttggccggtcatgacgctggggctagcgagttatacaaacat
gttgtttgcataaacgcggaccaaataaccgaagttgacaacgatagtattcctactgga
aaattactgccggtggccaacaccgtattcgacctccaagtccccaaagtcctcggcgat
gtcatcaccaaagtccccaacagcgacgggttcgaccacaatttttgcatcaacaagggc
cccgaacagggcacaacattcatcgcaagagtttaccaccctgagagcggcaggatgctg
gaagtgtacagcaaccagcccggtgtccagttttacacctcaaactttttccccgaaaac
cccaaaacatacaagggggacaaaaccaaactggcgactttgtcaggcaaaggtgcctcg
tactacaaacacggggccctctgtttggagactcaaaactggcccgatgccccaaaccac
gataatttcccgaagtcgattttggtgcccggcgagacgtaccaccacaacgtggcgtac
aaattctcagtgaagaattaa

DBGET integrated database retrieval system