KEGG   Tribolium castaneum (red flour beetle): 659368Help
Entry
659368            CDS       T01046                                 

Gene name
AChE-2, AChE
Definition
acetylcholinesterase 2
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    659368 (AChE-2)
Enzymes [BR:tca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     659368 (AChE-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEETLEBASE: 
Position
LG2
AA seq 661 aa AA seqDB search
KRHQSVITETDPSISNSSLNNWARSSMGSNLVVVVVVVVVVVASLSASARAYSWPSEETT
TRPPQARDFHSDPLVVETTSGLVRGKAKTVLGREVHVFTGIPFAKPPIEQLRFRKPVPID
PWHGILDATKLPNSCYQERYEYFPGFEGEEMWNPNTNISEDCLYLNIWVPQRLRIRHHGE
KLPQDRPKVPVLVWIYGGGYMSGTSTLDIYDADIIAATSDVIVASMQYRVGAFGFLYLSK
YFPRGSEEAPGNMGMWDQALAIRWIKENAAAFGGDPDLITLFGESAGGGSVSILLLSPVT
KGLARRGILQSGTMNAPWSYMSGERAQQIGKVLVEDCGCNVSLLETRPHEVIDCMRAVEA
KTISLQQWNSYSGILGFPSTPTVDGVFMPKHPMDMLAEGDYEDMEILVGSNQDEGTYFLL
YDFIDFFEKDGPSFLQRDKYHDIIDTIFKNMSRLERDAIVFQYTDWEHVNDGYLNQKMVG
DVVGDYFFICPTNDFAELAAERGMKVYYYFFTHRTSTSLWGEWMGVMHGDEIEYVFGHPL
NMSLQFNSRERELSLKIMQAFARFAATGKPVTDDVNWPLYTKDQPQYFIFNADKNGIGKG
PRATACAFWNDFLPKLRDNPDSAESPCVNTYLSKMGSSSGRASTRTLLEILIHLMLALSA
L
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
aaacgccaccaatccgtcataaccgaaacggatccctctatttcaaattcatcacttaat
aattgggcccgaagcagcatgggttcgaatctcgtcgtcgtcgtggtcgtcgtggtggtg
gtggtggcgtcgctgagtgcttccgcccgcgcctactcctggcccagcgaggagacgacg
acgcgtccgccccaagccagagactttcacagcgacccgctggtggtggagaccaccagc
ggcctggtgcggggcaaggccaagacggtgctgggccgcgaggtgcacgtcttcaccggg
attcccttcgccaagccgcccatcgaacagctgaggttcaggaagcccgtgcccatcgat
ccctggcacggcatcttagatgccaccaagctgcccaactcgtgctaccaggagcgctac
gagtacttccccggctttgagggcgaggagatgtggaaccccaacacgaacatctccgag
gactgcctctacctcaacatctgggtgccccagcgcttgcgcatccggcaccacggcgag
aagctcccccaggaccggcccaaagtccccgtcctcgtgtggatctacggcgggggctac
atgagcggcacctccaccctggacatctacgacgccgacatcatcgccgccacctccgac
gtcatcgtcgcctccatgcaatatcgcgtgggggcgttcggcttcctctacttgagcaag
tacttccctcgcggcagtgaggaggcgcccggtaacatgggcatgtgggaccaagccctg
gccatccgctggatcaaggagaacgcggcggcctttgggggcgacccagacctcatcacg
ctgtttggggagtcggctggaggcggctccgtcagcatcctgctcctgagtccggttact
aaaggcctggccaggagggggattctgcagtcggggactatgaacgccccttggagttac
atgtcgggggagagggcgcagcagatcgggaaggtcctggtggaggactgcgggtgcaac
gtctccttgttggagacgaggccgcatgaggtcattgattgcatgagggcggtggaggcc
aagacgatttcgctgcaacagtggaattcgtattcggggattttgggcttcccctcaacg
cctacggttgatggcgtcttcatgcccaagcatcccatggatatgctggcggaaggggat
tacgaggatatggagatcctggtcgggagtaaccaagatgaaggcacttacttcttactt
tacgattttatcgatttcttcgaaaaggatggccctagcttcctccaacgagacaaatac
cacgacattatcgatacgatattcaaaaatatgagtcggttggaacgtgatgccatagta
tttcagtatactgattgggagcacgtcaacgacggctacttgaaccagaaaatggtgggc
gacgtcgtcggagattattttttcatttgtccaaccaacgatttcgccgagctggcagca
gagcgcggaatgaaagtctactattattttttcacacacaggacaagcacgtcgttgtgg
ggcgaatggatgggggtgatgcacggggatgagatagaatacgtgtttggccatcctttg
aacatgtcgttgcagtttaactcaagggaacgggaactcagtctgaagataatgcaagcc
tttgccagatttgcagcaacggggaaaccagtgacagacgacgtgaattggccattgtac
acaaaagaccaaccgcagtatttcatcttcaacgccgacaaaaacggcatcggcaaaggt
cctcgagcgacagcgtgcgcgttttggaacgatttcctgcccaagcttcgggataaccca
gattcggcggagtcgccgtgcgtcaacacttacttaagcaaaatggggtcttcatctggt
agagcatcaactcgcaccctgttggaaattctcatccatttgatgctagctctaagcgca
ttgtag

DBGET integrated database retrieval system