KEGG   Tribolium castaneum (red flour beetle): 659399Help
Entry
659399            CDS       T01046                                 

Definition
GA19585-PA-like
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Enzymes [BR:tca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     659399
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     659399
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     659399
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG7
AA seq 366 aa AA seqDB search
MTPIRRVLVIYVGGTIGMERNENNVYAPSPNKLLQKLKFHSQMHDQVLAKKFIGELGYNQ
LVLPEIGNEVVLYELKEYNPLLDSSNMCSKDWIRIANDIGKNYDKFDGFVILHGTDTLAY
TSSALSFMLEGLQKPVILTGSQIPIFETRSDAKDNILSSLILAGCYKIPEVCIFFANKLL
RGNRTAKISSIHLNAFDSPNYQPLAEVGIDIKVNKHFILQPTSPFQVHTKLNSNVGLLSF
FPTITPCMFRAILQCPSVEGLVLQSYGVGNIPSNRTELLQVIEEAVRRETVIVNITQCPQ
GTVSATYETGKALEKIGVISGHDMTAEAALTKLCYVLGIPGLTYEQRVLLMKENIRGELT
NNNNIY
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaccccgattagaagagttttggtgatttatgtcggaggaaccattggaatggagcgc
aacgagaataatgtttacgctccgtcgccgaataagcttttacaaaaattgaagtttcat
tcacaaatgcatgaccaggtcttggccaaaaagttcatcggagagttgggctacaaccaa
ctggttttgcccgaaattggaaacgaagtcgttctttatgagttaaaggagtacaatccg
ttgctggattcgagtaatatgtgctcaaaggactggatccgaattgccaacgatattggg
aaaaattacgataaattcgacggttttgtgatacttcatggaactgacacgctcgcgtac
acatcgtctgctttatcatttatgttggaagggctccaaaagcctgtcattttgaccgga
tctcaaattcctatctttgagacgcgaagtgacgcgaaagacaacatcctatcgtcgcta
atcctcgccggctgttacaaaatccccgaagtttgcatttttttcgccaataaattactg
cgaggcaaccgaacggccaaaatcagctcaatacacttgaacgctttcgactcacctaat
taccagcctttggccgaggtcggaattgacataaaagtgaacaaacacttcattttgcag
cccacaagccccttccaagtccacacgaaattaaactcaaatgtgggtttgttgagcttt
ttccccactattactccatgcatgtttagggcaattttgcaatgtccgtcagttgaaggg
ttggttttgcaaagttatggggtcgggaatattccctcaaatcggaccgaattgcttcaa
gtgattgaggaagcagtgaggagggaaactgtgattgtgaatatcacgcagtgtccgcaa
ggcaccgtttcggcgacttatgagaccggaaaggcgcttgaaaaaatcggcgttatttcg
ggtcatgacatgacagctgaagccgctctcacgaaattgtgctacgtgttgggaatcccc
ggactgacgtacgagcaacgagttttgttgatgaaggagaatattcgaggcgagttgacg
aataataataatatttactga

  All links  
No link information was found.   
DBGET integrated database retrieval system