KEGG   Tribolium castaneum (red flour beetle): 659405Help
Entry
659405            CDS       T01046                                 

Definition
enoki mushroom CG11290-PA-like
Orthology
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Enzymes [BR:tca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     659405
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG8
AA seq 2385 aa AA seqDB search
MCEPEEVPQSVWSRWILDAIRKIRSQKQRPSVERICHAIRQHHNYHEDVVAEHLEAAVKE
CAVLKVFNKGQSSYKDPGGLQNRTLRIEKGTDLSKVVAKAVRELGERDGSTVKSIEKYIR
QSHTVVEGPDVELKNVLRMATKRAVARNLILQDGKNYKYNYNHTSPSSRKKQEAAKKALT
DDNDASSKTPAPLPICTECLGTESKNRNGVPEKLSACSECGALVHLTCTSAGPELAALLS
KGGKWFCEDCKTCDGCGNSGVSTCLLCCCSCERNYHVDCLDPPAEKKPKCPWRCRHCLGH
HDKSKKGEVSSNVKKKMEKVREKIKEKSQKSKEGSSPAGAITTTPSAKGNRKSRIPATPQ
PLDSDSDNSDSDNEGTPSPATSQHHHLQTPASHVHSPITTTTTTTTTNTDRLETSDRMSK
EKQKFFKSSAFNPDKKKQQDKTKKVSRTQQTNKKAEVETKRKQKKIVSSSSECSSSSEEE
TSTTDSDTDSSVEPSTTRSSIKIPSIFTSNTKKMETFGSISGITMDKDKPWGFAVAAAEA
KKKELASKEPLTFASFKNQTFGFESNKSFFPSLVDEKSSSNSSSSLDKTKPGFGQLRGLF
DGLSHLFAAATENRSRNSTPNYNPNRRPKKDDDEESEKSRKRANPTPPAPQFQSRKVSKC
PPLSSSPFSSCQESHQPMTPSNLVKTAVNSKRHELERRKIKSEAGLGTVGFGHNFEDARM
KKRNLIAEATQTNHPLSVPPTPIANNQTDEIKPPQLPPGVTQKDVDLFKETREKANATTA
LLPPGTPFVTSPSLVMSSQGRCPAAIEFGKYEIQTWYSSPFPQEYARLPKLFLCEFCLKY
TKSKAVLERHQDKCTWRHPPATEIYRCGDLSVFEVDGNVNKIYCQNLCLLAKLFLDHKTL
YYDVEPFLFYVLTKNDKKGCHLVGYFSKEKHCQQKYNVSCIMTMPQYQRQGFGRFLIDFS
YLLSKREGQPGTPEKPLSDLGRVSYYAYWKSVVLEYLHAHRNAKLKLTDISKETGMYCHD
IALALQLLGFVRCVSTETGRKPVLCIDWAKVDSHAERVSKSKTRIKIDAECLRWTPLLTS
TVNPFREEKSDGEKESTPAETADIVIPQPEKIIIETQQGVKLKKGRKRKISTAPKTPKVA
KSEPKTPQVTPNNPTKEEVEITSSGRRRTRPSKYNETTFADVKPKNHENNKRKRNDTSEP
EVAEKKMKVEPEVKLVKCDEEVAKTQPKETQRPKRNVGGNKEKVAGERWSQRRVKKQQEK
KEEVEEKEESVEKPEKIEVEASPAPVKTPKPRKKRPFVKTKTKKQLTLPELMKNKLQHRE
SESESLVSEKSEDEETTKKEVVNNEKVEVRVKNTKINRISTEEDSSAEADDEMEKDELAP
KAFEVSPNTKYKLPKSSPTKEKVEAVRKDLQKVEEKEVGKEPEKAKSPQVYSSTTSESET
EIDGQKIKTIHKEILEISKKDVLVDNQIKQEEVTKSEEKAEIKPVEATSQKSEEAPVEKV
ADQSIEFDRKSSDMDIEKIDDDRNKIVVQNAVPTSSPKGQPSPNIVEEKPKVVEEKPKIE
PEPQPSKPKPEPVVEEKKVETKPPTPPPETKTVITEKKPPKIEPPKAPEPVPETKTVVPA
VQSEPKPIKEKDVNPKTQAVAKTEPKPKHEEKRHHDKPKPAKVQHVENESLLAKTDFSMS
AAAQNYHHMSQAQYNQWQWGLTWDKSIYYDHKREYAGYPMPLQFPPLEMLPKQQLPSCEK
EKPKTHRHESKQSSSKSSKESKSDKTSPKKEEKTREAKNSSCSVKTAPLPEKPIPPCPVP
EKPKHKEDEKLESVELSQQQPPQQQPQQQPHQQQPMTTPSIKHTPPTPSSEIPSMGVYTP
DSTTNSVHSLHYGQCDLDVAQLGLESPASISSDMASQNSVEPVRPPSVLPVSIAQQQPQT
NYDCTVQHNLQQQSGLQVQQNATVPASSPTVNPTPMQMPQQNTHQSGSSKRQMQQPRNRS
STPSANKQQSSMKLASPAQQHASVQQQQQQSRQRATPPTVQTHQHMLASPTQNQQVQHQM
QQQHHMHHQVAMHQSYTHHAQLGASPMHQHPHHPHHSVINSGNYIPVAVSTQGFPAQGTS
TYVSVPMTTVIQHRMSAQQTHQKLAPSPSCAVTTGTNFYIQTNPHPHAHTPTPAPTPVPT
ATLQGPAQPGQSSCSLAKLQQLTNGLEMMPPNSCSTMTPPPSAMTLSPPPTHHPHATMTP
PPTHQMIQNQTVRNLAPSPSGIQPQVLSYHKYYQPNMNVNQLGGAVTPPIGQNLGRSRNA
TNVQHMQTTSSRVSPNVAALNPMYNSLNGYRMAAQQGPGSVSGYITNTAAGFINNAQIPM
QMGVMNMAQTQYQDPAAIQRAQQNTMYYGYINSGLMQPLNGTMRR
NT seq 7158 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgagcccgaggaggtgccccagagcgtgtggtcgcgctggatcctcgacgccatc
cgcaagatccgctcccagaagcagcggcccagcgtcgagcgcatctgccatgccatccgg
cagcaccacaactaccacgaagacgtggtcgccgagcacctggaggcggccgtcaaggag
tgcgccgtcctcaaggtcttcaacaagggccagagctcctacaaggaccccggcggcctc
cagaacaggacccttcgcatcgaaaaggggaccgatctgagcaaagttgtggcgaaggcc
gttagggagctaggggagcgtgacggctccaccgttaaatccatcgaaaagtacataagg
cagtcgcatacggtcgttgaagggccagatgttgaactcaaaaacgtgcttaggatggct
accaagagggccgtcgccagaaatctcatactgcaagacggcaaaaactacaagtacaat
tacaatcacacgagccccagttcccggaagaagcaagaagccgccaaaaaagccctcact
gacgataacgatgcttccagtaagaccccagccccattgcccatctgcaccgaatgcctg
ggcacggagtcgaaaaaccggaacggagtgcccgaaaaattgagcgcctgttccgaatgc
ggggctctcgtgcacctaacctgcacgtcggcggggcccgaactggccgccctgctgtca
aaagggggcaaatggttttgcgaggactgcaaaacctgcgatggttgcggcaattcgggg
gtttcgacttgtttgctgtgctgctgcagctgcgagcggaactaccacgtggactgcttg
gaccccccggcggagaagaagcccaaatgtccgtggcggtgccggcactgtttgggccac
cacgacaagtcgaaaaagggggaggtgagcagtaacgtgaagaaaaaaatggaaaaagtt
cgcgagaaaatcaaggagaagagtcagaagtcgaaagaggggagcagtccggccggggcg
attacgacgacaccgtccgcgaagggtaaccggaagagtcggataccagcgactccgcag
ccccttgacagtgacagtgataacagcgacagcgacaatgagggtacgccatcccccgcc
acttcacaacatcatcatctccaaactccagcctcccatgtccattcccccattaccacc
accaccaccactacaacaaccaacactgaccgcctagaaacctccgatagaatgtcgaaa
gagaaacaaaagttcttcaaatcgtcggcgttcaaccccgataagaagaaacaacaagac
aagacaaaaaaagtcagtcggacgcaacagactaataagaaagcggaagtcgagactaag
cgaaagcaaaagaaaatcgtgtcttccagttcggaatgttcgagtagtagcgaggaggag
acgagcactaccgactcggacactgattcttccgtcgaaccgtcgaccacgcggtccagt
atcaaaataccgagcatttttacgagcaacaccaaaaaaatggagacttttggtagcata
agcggtattacgatggacaaagacaagccgtggggcttcgcagtggcggctgccgaagcc
aagaagaaggaactggcgagtaaagaacccctcacattcgccagtttcaagaaccaaacg
tttggtttcgaaagtaacaaaagtttttttccgtcgctggtcgacgagaaaagctctagc
aattcgagcagtagcttagataagacgaagcccggcttcgggcaattgcggggtttgttc
gacggtttgagccaccttttcgccgccgccaccgaaaaccggtcgagaaactcgaccccg
aattacaaccccaatcggcggccgaaaaaggacgatgacgaagagtccgagaagagtcgc
aaacgtgcaaatcccactcctcccgccccccaattccagtccagaaaggtgtccaaatgt
cctccgctatcgtcttcccctttctcttcctgtcaagagagccaccagccgatgacgcct
tctaacctcgttaagacggccgttaattcgaaacgtcacgagctagaaagaaggaaaatt
aaaagcgaagcagggttgggtacggtcgggttcggacataatttcgaggatgctcgaatg
aaaaaacgcaatcttattgccgaggccacacagacaaaccatccgttgtcggtgccgccg
acgccgattgccaacaatcagaccgacgaaatcaaaccgccgcaactgccgccaggtgtg
acgcaaaaagacgtcgatttgtttaaagaaacgcgagaaaaggccaatgcgacgacggcc
ctcctaccacccggaacacccttcgttacgtcaccctcgctggtgatgtcgtcgcaaggc
cgttgccccgccgccatagaattcggaaaatacgaaatacaaacgtggtactccagcccc
ttcccgcaggaatacgccagactacccaaactgttcctgtgcgaattctgcctcaaatat
accaagagtaaggcggttctcgaacgccaccaagacaagtgcacctggaggcacccgcca
gcgacggaaatctaccgatgtggcgacctatcggtgtttgaagtcgacgggaatgttaac
aaaatctactgtcagaatctctgtctcttagccaaacttttcctcgaccataaaacgctc
tactacgacgtggagccattcctattttatgttttgacgaaaaatgacaagaaagggtgc
caccttgtcggttatttctcaaaagagaagcattgtcagcagaaatataacgtttcgtgt
atcatgacaatgcctcagtaccagcgacaaggtttcggccgatttttgatcgattttagt
tacttactgtcgaagagagagggacagccgggaacccccgaaaaaccactctccgacctc
ggacgagtctcgtattacgcttattggaagtcggtggtactcgaatacctccacgcacac
cgcaatgctaagttaaaactgacagatataagtaaagaaacggggatgtactgccacgac
atcgctcttgccttacaactgctcgggttcgttcggtgcgtttcgaccgaaaccggccga
aaaccagtgctttgcatcgattgggcgaaagtcgacagtcacgcggaacgcgtctctaaa
agtaaaactaggattaaaatcgacgccgagtgtctcagatggacaccgctcctgacatca
accgtaaatccattcagggaagaaaaatccgacggcgaaaaagaatcaacaccggcggaa
actgccgatattgtaatcccccagcccgagaaaatcataatagaaacgcagcaaggagtc
aaattgaagaaagggcgcaaacgaaaaatttccaccgcgccaaagacgccaaaagtggcc
aaaagcgagcccaagacacctcaagtcacgcctaataatccgactaaggaagaggtggaa
ataacgtcgtcgggtcgcagaagaacgaggcctagcaaatacaacgaaacgacattcgcc
gacgtcaagcctaaaaaccacgaaaataataaacgcaaacgtaacgatacatccgagccg
gaagtagccgagaagaagatgaaagtcgagccggaggtaaaacttgtcaagtgtgacgaa
gaagtcgcaaagacccaaccgaaagaaacacaaaggccgaagcggaacgtcggcggtaat
aaagaaaaggttgcgggtgagaggtggtcacaaagacgcgtcaagaaacaacaggagaag
aaggaagaagtggaagagaaggaggaaagtgtcgaaaaaccggaaaagattgaagtggaa
gcgtctccagcaccggtcaagactccaaaaccgaggaagaagcggccgtttgtgaaaacc
aaaacgaagaaacagttgacgttgcctgaacttatgaagaacaagcttcaacacagggag
agtgaaagtgagagtttggtgtcggaaaaatcggaggatgaggaaaccacgaagaaggaa
gttgttaataatgagaaggttgaggttcgagtgaaaaatacgaagatcaataggatttcg
accgaggaggattcgagtgctgaggccgatgatgagatggagaaggatgagttggcgccg
aaggctttcgaagtttcgcctaataccaaatacaagttgcctaagagtagtcctacgaaa
gagaaggttgaagcggttagaaaagatttacaaaaggttgaggagaaggaagttgggaag
gagccagagaaagcgaagtcgcctcaagtttattcgtccacgacctcggaatcagagact
gagattgacgggcagaaaatcaagacgatacataaggaaatattggagatttccaaaaaa
gacgttttggttgataatcagattaaacaggaagaagtaactaaaagtgaggagaaggcc
gagattaagccggtcgaagctactagtcaaaagagtgaagaagcacctgtggagaaagtc
gcggatcaatcgattgagtttgatagaaaatcgtctgatatggatattgaaaaaatcgat
gacgatcgaaataaaatcgttgttcaaaatgcggtgccgacttcttcacctaaaggacag
ccgtcaccgaacattgttgaggaaaaaccgaaagttgttgaagaaaaaccgaaaattgag
cctgaacctcaaccgtctaaacccaaacctgaaccggtcgtagaggaaaagaaagttgag
acaaaaccaccgactccacctcctgaaactaaaaccgtaatcacggaaaagaaaccgccg
aaaatcgaaccccctaaagcacccgaaccagttcctgaaaccaaaactgtagttccggcg
gtacaaagtgaaccgaaaccgattaaagaaaaagatgtgaatcccaaaactcaagctgtt
gccaagactgaacccaagcctaaacatgaggaaaagcggcatcacgacaaacccaaaccg
gccaaagtacaacacgtcgaaaacgagagtcttttggctaaaaccgactttagtatgagt
gcggcggctcagaactaccaccacatgtctcaagctcagtacaatcaatggcagtggggt
ttaacctgggataagtcgatttattacgaccataaacgagaatatgccggttatcccatg
cctttacaattccctcctttggaaatgttgcccaaacaacaacttcccagttgcgagaaa
gaaaaacccaaaacacaccgacacgagtcgaaacagagcagtagtaagagttccaaagag
agcaaaagcgataaaacttcgcccaaaaaggaggagaaaacaagagaagcgaaaaactcg
tcgtgttccgtgaaaacggccccacttccggaaaaaccgatccccccgtgcccagttccg
gaaaaaccgaagcacaaagaggatgagaaattggagagtgtggagctgtcgcaacaacaa
ccaccacaacagcaaccccagcaacagccccaccaacaacaaccaatgaccacaccttcg
atcaaacacacacctccgactccttcgtccgagattccttcaatgggagtctacacacct
gattccacgacaaattccgtgcatagtttgcactacggtcagtgcgatctcgacgttgct
caattaggtctcgaatcaccggcgtccatttccagcgatatggcgtcacaaaattcggtc
gaaccggtgagaccgccgtcggttttaccggttagtatcgcccaacaacaaccacaaact
aattatgattgtaccgtgcaacataatttgcaacagcagagtggtctacaggtacaacag
aacgcgaccgtaccggcttcgagccccacagtgaaccccactccgatgcaaatgccccaa
caaaacacgcaccaatcgggttcaagcaaacgccaaatgcaacagccccgaaaccggtct
agcaccccatcggccaataaacaacagtctagtatgaaactggcctctcctgctcaacag
cacgcctccgtccaacaacagcaacagcaaagccggcaacgagccacgccccctactgtc
caaacccaccaacacatgttagccagtcccacccagaaccagcaagtccaacatcagatg
caacaacagcaccacatgcaccatcaagtcgccatgcaccagagctacacccaccacgcc
caactgggggcgtccccaatgcatcaacacccccatcatccccaccattccgtcattaat
tcagggaattacatcccggtggccgtcagtacccaaggattcccggcgcaaggtaccagc
acttacgtgagtgtgcccatgacgacggtcatccagcaccggatgagtgcccaacaaacc
catcaaaagctggccccatcgccgtcgtgcgccgtcaccacgggaacaaacttctacatc
cagaccaatccgcatccacatgcacacacccccactcccgcccctacaccagtcccgacg
gcaactttgcaaggccccgcccagccaggccaatcgagttgtagcctcgccaaattgcaa
cagttgacgaatgggttggagatgatgccacctaattcctgtagtacgatgactccgcct
ccatcggcaatgacactatcgccgcctccgacgcaccacccacatgccacgatgacgccg
ccccccacgcaccaaatgatccagaatcagaccgtccggaacctggcgccgtcgccgtcc
gggatccagccgcaagttctgagttaccacaagtattaccaaccgaacatgaacgtgaat
cagttgggaggggcggtcacgccgccgattggccagaatttggggcggtcccggaacgcg
acaaacgtccagcatatgcagacgacgtcgagtcgggttagcccgaatgtggcggcgttg
aaccccatgtataactcgctgaatgggtacaggatggcggcgcaacaggggccgggatcc
gtgtcggggtacataaccaacacagcggctgggtttataaataacgcccagattcccatg
cagatgggcgtgatgaacatggcccagacccagtaccaggaccctgcggccatccagagg
gcacaacaaaacaccatgtactacgggtacatcaacagtgggctgatgcagccgctgaat
ggcacgatgagacgttaa

DBGET integrated database retrieval system