KEGG   Tribolium castaneum (red flour beetle): 659421Help
Entry
659421            CDS       T01046                                 

Definition
serine/threonine-protein kinase Doa
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Enzymes [BR:tca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     659421
Protein kinases [BR:tca01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   659421
Spliceosome [BR:tca03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    659421
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 692 aa AA seqDB search
MYATGLSYRYHRPDDRYTNGSTGWDKNGGDHTAVAMAAPNSSRRTRYSRSSTTSVAQLLS
ESCSTLLQKLTTKVRGPSESSSTATPKRSFNPLATSKSSTTIPNFGSTRTRLEDKYSSVL
EKIYGRKRDPERTIEPSLAKSATTSNVLLAEKTYPYVSTREKTPYRSDKSRNNNYRKYQE
PPYTYLDQDSAYRVRYRSNHSELRPRRASKPLLRAGKSELNDRNLKLHAVEIPLDDGPVP
VHIPKPQVIDNETTPTPAVPDPLSEREAKRKEIQSLIMKYSALDEVYNRGVNGGAVAVPP
TSSVSGAATAIAKKYHPAASRYAVSSRAPSVEDDEEGHLIYRSGDILQDRYKILGTLGEG
TFGKVVKVKDLEMDHSMALKIIKNVEKYREAAKLEINVLEKLADKDPDCIHLCVKMLDWF
DYHGHMCIAFEMLGLSVFDFLKDNNYQPYPLDQVRHIGYQLCYSVKFLHDNKLTHTDLKP
ENILFVDSDYDLVYNSKKRRDVKRVKRTDVRLIDFGSATFDHEHHSTIVSTRHYRAPEVI
LELGWSQPCDVWSIGCILFELYLGITLFQTHDNREHLAMMQRILGEVPVRMARKTKTKYF
YRGKLEWDEKSSAGRYVRDNCKPLMRYKQSDESDHNQLFDLIFKMLDYEPSQRITLKEAM
LHPFFDKIAPHQRLGEHGAGDVRRDKSLSMSR
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgtacgccaccgggttgtcgtataggtaccatcgtccggacgatcggtacaccaatggt
tccactggatgggacaagaacggcggtgatcacaccgccgtcgcgatggcggcgccgaat
tcctcgcgtaggacgcgatattcgcgctcgtcaacgacaagtgttgcacaattattgagc
gaatcgtgttccactctcctacaaaaattgacaacgaaagtgagaggaccgtcagaatca
tcctcaacggccacaccaaagaggagttttaaccccttagcgactagcaaaagtagcaca
actatacctaacttcggttcgacgcgaacacgcctcgaagacaagtattcaagtgtcttg
gagaagatctacggacggaaacgggatcccgaacggacgattgaaccctcacttgccaaa
agtgcgaccacttcaaacgtactacttgcggaaaaaacgtacccttatgtcagcacgcgg
gaaaaaacgccgtatcgaagcgacaaaagccgcaataataattaccgcaagtaccaggaa
ccaccgtacacttacctggaccaggactccgcttatcgggtccgttaccgttcgaaccat
tccgagctgcgcccgcggcgggcctcaaagcccctgctgcgggcgggcaaaagcgagctt
aacgatcgaaatttgaagcttcacgccgttgaaatcccgcttgacgatgggccagtgccc
gtccacatccccaaaccgcaagttatcgataatgaaacgacgccaacgcctgccgttccc
gatccgttgtcggaacgggaagccaaacgtaaagaaattcaaagtctgattatgaaatat
tcggcgttagacgaggtgtataatcggggtgttaacggtggggcggttgcggtaccaccg
acgagttcagtctcgggggctgctaccgccattgctaagaaatatcatccggcggcgtca
agatacgcggttagctcacgcgcgccctcagtggaagacgatgaagaaggccatctcatt
taccgatcgggagacattcttcaagaccgatataaaatacttggcactctcggcgaaggc
acctttggcaaggtggttaaagtgaaggaccttgaaatggaccactcaatggcattaaaa
attataaaaaatgtggaaaagtatcgagaggctgctaaattagaaattaacgttttggaa
aaattggccgataaagatccagactgtatacacttgtgtgtaaagatgttggactggttc
gactatcacggccatatgtgtatagcttttgaaatgttgggtctgagcgtgtttgacttt
ttgaaagacaacaattaccaaccgtatcctttggatcaagtgagacatattggatatcag
ctgtgctattctgttaaatttttacatgataataaactgacgcacactgatctcaagccg
gagaatattctattcgtcgattcggattacgacttagtttataatagtaaaaagaggaga
gacgtgaaaagagtaaaaagaactgatgttagattaatagactttgggagtgctacgttt
gaccacgaacatcatagtactatagtctcgactcgtcattacagagctcctgaggttatt
ttagaattagggtggtcacaaccgtgcgatgtttggtcaatcggttgtattttattcgaa
ttgtatctgggaatcaccctcttccagacacacgataatcgcgaacacttagctatgatg
caacgtattcttggggaggtgccagttaggatggcacgcaagactaaaacaaaatacttc
taccgtggtaagttagagtgggatgagaagagttcggcaggtcgttatgtccgtgataat
tgtaaaccattaatgaggtacaaacaaagtgacgaatcggaccacaaccagctcttcgat
ttgatttttaaaatgttggattatgagccgtctcagaggataacgttgaaggaggcaatg
ttgcatcccttctttgataaaatcgccccgcatcaacgtttgggtgaacatggcgctggt
gacgtcagaagagataaaagcttgtcgatgtcgcgatga

DBGET integrated database retrieval system