KEGG   Tribolium castaneum (red flour beetle): 659541Help
Entry
659541            CDS       T01046                                 

Definition
AGAP005226-PA-like
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Enzymes [BR:tca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     659541
Peptidases [BR:tca01002]
 Cysteine Peptidases
  Family C86
   659541
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG9
AA seq 221 aa AA seqDB search
MNLNDIYHEKQVRELCALHALNNLFQSKDAFTKPELDVICHSLSPDNWINPHKSVLGLGN
YDINVIMKALQSRGYETIWFDKRKDPSCLNFKNICGYILNVPSEYKISFITLPLRRRHWI
TIRQLNGLFYNLDSKLESPQIIGRESDLLNYLKEELDCRDKELFLVVTNDVGKEQSWLKN
QASYSNNLQEREAEIVQLRDITSDDVNVTINPLCNSRSDWS
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgaatgacatctaccatgagaagcaagtgagggaattatgtgctttgcacgct
ttaaacaacctctttcaatcgaaagatgcatttacgaagccggagctcgacgtaatttgc
cattcgttgtcccctgacaattggataaacccccacaagtccgtgctggggctggggaac
tacgacattaacgtcataatgaaggcgttgcaatcgcggggctatgaaacgatttggttc
gataaacgaaaagacccgagttgtttgaattttaagaatatctgtgggtacattttgaac
gtccccagcgagtataaaatcagttttatcacactgcccctacgcaggaggcactggatc
acaatcaggcaactgaacggattgttttataatttagattcgaaattagagtcgccccaa
ataattgggagggagtctgacctcttgaattatttaaaagaagagctggattgtagggat
aaggaattatttttagtcgttacgaatgacgtggggaaggagcagagctggttgaagaat
caagcgagttacagcaacaatctccaggagagggaggccgaaatagtgcagttgagggac
ataacaagtgatgatgttaacgttacaatcaatcccttgtgtaatagtagatcagattgg
tcttaa

DBGET integrated database retrieval system