KEGG   Tribolium castaneum (red flour beetle): 659551Help
Entry
659551            CDS       T01046                                 

Definition
protein disulfide-isomerase A5
Orthology
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Enzymes [BR:tca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     659551
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG10
AA seq 620 aa AA seqDB search
MKHFNTIFFLLLAFEINIYLTKDTKNAVVDNIYDIKEFKKLIRTKTNVLVCYTNSIKQAS
QVIKVFREAADVIKGQGTMVVMDCSGEAKKVCKKLKVTPDPFIFKHYKNGEFNRDYDRKF
TVSSMVNFMRDPTGDLPWEEDASASDIVHVPDAETLAKFIRQESRPLMVMFYAPWCGFCK
TLKPEYVAAAKELKGHSVLAAIDVNKPENAVIRTLYNITGFPTLLYYKNGAMKFQYEGDN
KRQAIVNFMKNPSKPVKVKEQEWSEVDSEVVHLTTTNFDPVVKEEASLLVMFYAPWCGHC
KKIKPEYEKAAAKLKSDGIPGMMAAVDATKEVSIADRFSVKGYPTMKYFTYGEHKFDINL
REATKIVEFMKNPKEPPPPPPPEKPWSEEESSVVHLNEENFKSFLKKKRHALVIFYAPWC
GHCKKAKPEFTKAAEFFKDDPKVEFAAVDCTTYQGVCSAHEVSGYPTIKYFSYLNKVVKA
YNSGRTADDFIAFMSDPEGNGSSQKTIVPQLTDANFEEEISSKSAVLVMFYAPWCKQCKE
IKPEYQKATNELKQDGFIAQLASVDCSSNPVVTDKYDIGTFPTFKLFLNGKFAADFTGKS
TKDDIKSFVVDVKNRKNKEL
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatttcaacacgatattttttcttcttctggccttcgaaattaacatctattta
accaaggacacaaaaaatgctgtcgttgataacatttacgatatcaaggagtttaaaaaa
ttaatcaggacaaaaacgaacgttttagtttgttacacgaattcgatcaagcaggcgtcc
caagtgatcaaggtctttagggaagcggctgatgttatcaaggggcaaggcaccatggtt
gtaatggactgttcaggggaggcaaaaaaagtttgtaaaaagttgaaagtcacccctgat
cctttcattttcaaacattacaaaaatggggaatttaaccgcgactatgacagaaaattt
accgttagttcaatggttaatttcatgagggaccccactggggacttaccttgggaggaa
gacgcctctgctagtgatattgtgcacgttccggacgctgagactttggctaaatttatc
agacaggaaagcaggcctttgatggtcatgttttacgccccctggtgtggtttttgcaaa
actttgaagccggaatatgtggcagcggctaaagaactgaaaggacactcggttctggcc
gccattgatgtaaataagcctgaaaacgccgtcattaggaccttgtacaatattacggga
ttccccacacttttgtattacaaaaacggtgcgatgaaattccaatacgaaggcgacaat
aagcgccaagccatcgtcaattttatgaaaaacccctcaaagccggtgaaagtcaaggaa
caagaatggtctgaagtcgacagcgaagtcgtccacttaaccacgaccaactttgacccc
gttgttaaagaggaagcgtctttgcttgtaatgttttacgccccttggtgtggccattgt
aagaaaatcaagcccgaatacgaaaaagccgccgctaagctcaaatcagacgggattcca
ggtatgatggccgcggttgatgcaacgaaagaagtgagtattgctgaccgtttctcggtc
aaaggctaccccacgatgaaatatttcacgtacggggaacacaaatttgatattaatttg
cgagaagcgacaaaaattgtcgagtttatgaaaaatccaaaagaaccaccgccgcctcca
ccaccggaaaaaccatggtcggaggaggagtccagtgttgtgcatttgaacgaagagaat
tttaaaagttttcttaaaaagaaacgacacgcacttgttattttctacgcaccttggtgt
ggccactgcaagaaagctaaacccgaattcaccaaagcagcggaatttttcaaggacgat
cccaaggttgagtttgcagcagtggactgtacgacgtatcagggcgtttgttcggctcat
gaagttagcggttatcccaccattaagtatttcagttatttgaataaagttgttaaagcg
tacaactcaggccggacggccgatgatttcattgcgtttatgtcagatccagaaggcaat
ggctcaagtcaaaaaacaattgttccacaattgactgatgccaactttgaggaagaaatc
tcaagcaagtcggctgtgcttgtcatgttttatgcaccatggtgcaaacagtgcaaagaa
ataaaaccagagtaccagaaagccaccaatgagttgaaacaggacggatttattgctcaa
ttagcttcagttgactgtagttcgaatcctgtagtcactgataagtacgacattggcaca
tttcccacttttaagttgtttttaaacggtaagttcgcggccgactttaccggcaaaagt
acgaaagacgatattaaaagtttcgtggttgatgtgaaaaatcgtaaaaataaggaattg
tga

DBGET integrated database retrieval system