KEGG   Tribolium castaneum (red flour beetle): 659674Help
Entry
659674            CDS       T01046                                 

Definition
similar to AGAP005898-PA
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
FoxO signaling pathway
Wnt signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:tca04310]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:tca04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG9
AA seq 448 aa AA seqDB search
MAVVGPSRHSRVSMSVSMSLMQGTAGPTAGGQQGGLHAAQPYYHPQHAAAPAHTQEQVQP
DRPIGYGAFGVVWAVTDPRDGRRVALKKLPNVFASLVSSKRVFRELKMLCFFKHENVLSA
LDILQPPHLDFFQEIYVITELLQSDLHKIIVSHQPLSSDHIKVFLYQILRGLKYLHSARI
LHRDIKPGNLLVNSNCVLKICDFGLARVEEPDSSKHMTQEVVTQYYRAPEILMGAKHYTA
AVDVWSVGCIFGELLGRRILFQAQNPVQQLELITELLGTPSLDDMKYACEGAKTHMLRRA
PKPPSLSAFYTLSSQATHEVVHLLCQMLVFDPDKRISVVDALAHPYLDEGRLRYHSCMCK
CCYTTASGMRQYTSEFETTAPQGFDDHWEKKLTSVQHVKEEMHKFIAEQLNTSRVPLCIN
PQSAAFKSFASSTVAHPSELPPSPHQWD
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggtgggccccagccgccactcaagggtgtccatgtccgtgtccatgagtctg
atgcagggtaccgccggccccaccgccggggggcagcaagggggcctgcacgcggcgcag
ccctactaccacccccagcatgcagcggccccggcgcacacccaggagcaggtccagccg
gaccgaccgatcggatacggagctttcggagtcgtttgggcggtgacggatccccgcgac
ggcaggagggtcgccctgaagaagttaccgaatgtgttcgcatcgttagtttcatcgaaa
agagtgtttagagaactgaaaatgctctgctttttcaaacacgaaaacgttctttccgcc
ttagatatcctccaaccgcctcacttagacttcttccaggaaatatatgtaataacggaa
ttgcttcaaagcgatttacacaaaattatagtatcacaccagcctctttcctcggatcac
atcaaggtgtttctctaccagatacttagaggtttaaaatatttacattcggctaggata
ttacatagagacataaaacctggaaaccttttagtaaacagcaattgtgttcttaagatc
tgtgattttggtttagcgagagtagaagaacccgactcgtccaaacatatgacccaagaa
gtggtaacgcagtattacagagctccggaaattctaatgggagcgaaacattacacggcg
gctgtggacgtgtggtctgtcgggtgcattttcggggaattactgggccggaggatactg
ttccaggcccaaaatcccgtacaacaattagaattaataacggaattgttaggaacgccg
tcgttggacgatatgaaatacgcctgcgaaggcgccaagacgcatatgctgaggagggcg
cccaagccgccttcgttatcggctttttacacgctgagttcacaggcgacgcacgaagtg
gtccatctgctctgtcagatgctcgtttttgacccggacaaacgtatctcggtagtggac
gccttggcgcacccctatttggacgagggccgtctgcggtaccactcgtgcatgtgcaaa
tgctgctacacgacagccagcggcatgagacaatacacgtccgaatttgaaacgaccgcc
ccccaaggattcgacgatcattgggaaaagaagctgacgtctgtacaacatgtgaaagag
gagatgcataagttcatagcagagcaactgaatactagtagagttcctctttgcataaac
ccccaatctgcggcgttcaagagtttcgccagttcgactgtagctcacccatccgagttg
cctccttcgccccaccaatgggattga

DBGET integrated database retrieval system