KEGG   Tribolium castaneum (red flour beetle): 659715Help
Entry
659715            CDS       T01046                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Enzymes [BR:tca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     659715
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEETLEBASE: 
Position
LG4
AA seq 243 aa AA seqDB search
MRYILLLSTLLISCSVMAWRSHGKTNAELIRNLRANGIIRSDAVESAMLSVDRGNYSRNN
PYMDAPQGIGYGVTISAPHMHAHALELLKDKLLNGNRALDVGSGSGYLTACMAIMLGEKG
IAVGIDHMPELVEMSIKNIERDQPELLQSGQLRLLLGDGRQGYPDLGPYDAIHVGAAAPT
LPQPLVDQLKVGGRLIIPVGPAGGDQQLEQIDKLPDGSIQRKSLMGVVYVPLTDKSNQWP
RSY
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgcgatatatattgctactgagtactttattgatctcttgttcggtgatggcgtggagg
tcccacggtaaaaccaacgccgaactaattcgaaatctgagagcgaacggaattataagg
agcgatgccgtcgaaagtgcgatgctgtcagtggacaggggcaactattccagaaacaac
ccctacatggacgctccgcaaggcataggttacggggtcaccatcagtgccccccatatg
cacgcccatgctttggagctcctcaaagacaaacttttaaatggtaatagggctctggat
gtgggttctgggagtggctaccttaccgcatgcatggccatcatgttgggggagaaagga
attgccgtcggaattgaccacatgccagaactggtcgaaatgtccatcaaaaatattgaa
agagaccaaccagaattattacagtctggccaactgaggcttctgttaggtgatgggcgg
caagggtaccccgatttggggccctatgacgctatacacgtgggggcagctgccccaact
ttgccccaaccccttgttgatcaactgaaggttgggggcaggctaataatccccgtgggc
cccgctgggggcgatcaacagttagagcaaattgataaattaccagatggttccattcaa
cgtaaatctcttatgggtgttgtctatgtacctcttactgataaatccaaccagtggcct
cgttcgtattga

DBGET integrated database retrieval system