KEGG   Tribolium castaneum (red flour beetle): 659747Help
Entry
659747            CDS       T01046                                 

Definition
putative phosphoglycerate mutase-like
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    659747
   01230 Biosynthesis of amino acids
    659747
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    659747
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    659747
Enzymes [BR:tca01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     659747
Exosome [BR:tca04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   659747
  Exosomal proteins of melanoma cells
   659747
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG1=X
AA seq 256 aa AA seqDB search
MAPYKIVMVRHGESEWNEKNLFCGWYDANLSEKGKQEAVSAGKALKDAGYKFDIAYTSVL
TRAQNTLQSILKEIGQTDLPVVKTWRLNERHYGGLTGLNKAETAAKYGDEQVAIWRRSFD
VPPPAMEPDHPYYENIVKDPRYKDGPAPDQFPKYESLKLTIERTLPFWNDTIVPEIKAGK
QILIAAHGNSLRGIVKHLDQMSDEQIMKLNLPTGIPFVYILDENLKPTANGSLQFLGDPE
TVKKAMEAVANQGKAK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggccccgtacaaaattgtgatggttcgtcatggcgagtccgaatggaacgaaaagaat
ctgttttgtgggtggtacgatgcaaatctcagcgaaaaaggcaaacaggaagctgtcagc
gccggaaaagccctcaaagacgccggttacaaattcgacattgcctacacatcagtatta
acacgcgcccaaaataccctccaatcaattttgaaggaaattgggcaaacagacctgcca
gtggtgaagacctggcggctgaacgagcgccattatgggggcctgaccgggctaaacaag
gccgaaacggccgccaaatacggcgatgagcaggtggctatttggcggcgcagcttcgac
gttccgcccccagccatggaaccggaccacccctactacgaaaacatcgtcaaggacccc
cgctacaaggacggaccggcccctgatcagttcccgaaatatgagtcactcaagctcaca
attgagcgcactcttcccttctggaacgacacaatcgttcccgaaattaaagccggcaaa
caaatcctcattgccgcccatgggaacagtctgcgtggcatcgtcaaacatttggatcaa
atgagtgacgagcaaattatgaaactgaaccttcccactggcataccatttgtctacatc
ttggatgagaacctcaaacccacagctaatggcagtcttcagttcttgggggatccagaa
acagttaaaaaggccatggaagcggtggccaaccaaggcaaagccaagtaa

DBGET integrated database retrieval system