KEGG   Tribolium castaneum (red flour beetle): 659747Help
Entry
659747            CDS       T01046                                 

Definition
putative phosphoglycerate mutase-like
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:tca01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tca01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tca00010]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:tca00260]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG1=X
AA seq 256 aa AA seqDB search
MAPYKIVMVRHGESEWNEKNLFCGWYDANLSEKGKQEAVSAGKALKDAGYKFDIAYTSVL
TRAQNTLQSILKEIGQTDLPVVKTWRLNERHYGGLTGLNKAETAAKYGDEQVAIWRRSFD
VPPPAMEPDHPYYENIVKDPRYKDGPAPDQFPKYESLKLTIERTLPFWNDTIVPEIKAGK
QILIAAHGNSLRGIVKHLDQMSDEQIMKLNLPTGIPFVYILDENLKPTANGSLQFLGDPE
TVKKAMEAVANQGKAK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggccccgtacaaaattgtgatggttcgtcatggcgagtccgaatggaacgaaaagaat
ctgttttgtgggtggtacgatgcaaatctcagcgaaaaaggcaaacaggaagctgtcagc
gccggaaaagccctcaaagacgccggttacaaattcgacattgcctacacatcagtatta
acacgcgcccaaaataccctccaatcaattttgaaggaaattgggcaaacagacctgcca
gtggtgaagacctggcggctgaacgagcgccattatgggggcctgaccgggctaaacaag
gccgaaacggccgccaaatacggcgatgagcaggtggctatttggcggcgcagcttcgac
gttccgcccccagccatggaaccggaccacccctactacgaaaacatcgtcaaggacccc
cgctacaaggacggaccggcccctgatcagttcccgaaatatgagtcactcaagctcaca
attgagcgcactcttcccttctggaacgacacaatcgttcccgaaattaaagccggcaaa
caaatcctcattgccgcccatgggaacagtctgcgtggcatcgtcaaacatttggatcaa
atgagtgacgagcaaattatgaaactgaaccttcccactggcataccatttgtctacatc
ttggatgagaacctcaaacccacagctaatggcagtcttcagttcttgggggatccagaa
acagttaaaaaggccatggaagcggtggccaaccaaggcaaagccaagtaa

DBGET integrated database retrieval system