KEGG   Tribolium castaneum (red flour beetle): 659751Help
Entry
659751            CDS       T01046                                 

Definition
general transcription factor IIH subunit 4
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:tca00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    659751
  Replication and repair
   03420 Nucleotide excision repair
    659751
Transcription machinery [BR:tca03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     659751
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG7
AA seq 472 aa AA seqDB search
MADAEPAQPSSLFLKPTNLECKNLYDYLKTRSSATLEKLYNHPTICLAVYRELPELARQY
VIRILFVEQPVPQAVVASWGAQAFSKEHVYVSKVLSELSVWQEAAIPGGLLGWILSVTFK
KNLKIALLGGGKPWSMSSALEVDSKARDVSFLDAYSLERWECVLHYMVGSQQQEGISADA
VRILLHAGLMKRDEEDGSPVITRQGFQFLLLDRQAQVWHFLLQYLDTVEQRGLSLVECLT
FLFQLSFSTLGKDYSTEGMSPGLLIFLQHLREFGLVYQRKRKAGRFYPTRLALNITCSQG
PETRILEEDTPKGYIIVETNYRVYAYTDSNLQVALIGLFTELMYRFPNLVVGVITRDSIR
QALKGGITADQIIGYLKQHAHPQMLEGEAKHPLPPTVVDQIKLWEIERNRLTYSEGVLYS
QFLSQADFNILKEYAQSNGHLIWCNKEKRTLIINKSAHDDVKKFWKRYSKGN
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgccgagcccgcgcaacccagctcgctttttttgaaaccaacaaacttagaa
tgtaaaaacttgtacgactacttaaaaacgcgctcttcggcaacgttggaaaaactctac
aaccatccaacgatttgtttggccgtttaccgagaattgccagaactggcacgccagtac
gtgattcgaattttgttcgttgaacagccggtgccccaggcagttgtggcgtcatggggg
gctcaggccttttccaaagagcacgtttatgtgagtaaggttttgagcgaattgtcggta
tggcaggaggctgcgattccaggggggctcctaggttggatcctttcagttacgtttaaa
aagaatttgaaaattgccttattaggggggggcaaaccttggagcatgtcttcggcttta
gaagttgacagtaaggcaagagatgtgtcttttttggacgcttattcgctcgaacggtgg
gaatgtgtgttacattacatggtggggtcgcaacaacaagagggaatttctgcggatgct
gtcagaattttactacacgctgggcttatgaaaagagacgaggaagatggcagtcctgtt
ataacacgtcaaggcttccagtttttactcttagataggcaagcacaagtttggcatttt
ttactccaatatctcgacacagttgagcaaagaggattaagtctggttgaatgtttaacg
tttttattccaactctcatttagtacacttggaaaagattatagcactgaaggcatgagt
cccggccttttaatttttctccaacacttgagagaattcggattagtgtatcaaagaaaa
cgcaaagcaggccgtttttacccgaccagattggccttaaatattacgtgtagccaaggc
cccgaaactcgaattttggaggaagacactccaaaaggttacataattgtagagacaaac
tacagggtttatgcttacacggattctaatcttcaagttgctttaattggtcttttcaca
gaactgatgtataggtttccgaaccttgtagtgggcgtaataacacgtgattccataaga
caggctttgaaagggggaatcacagccgatcaaattatcgggtacctcaaacaacatgca
catcctcaaatgttggaaggtgaggccaaacatcctctacctccgacagttgtggatcaa
atcaaactgtgggaaattgagcggaacagattaacgtattcagagggcgttttatacagc
caattcctatcacaggctgattttaatatactgaaagagtatgcacagtctaatggccat
ctaatttggtgtaacaaagaaaaacggactctaatcatcaataaatcggcacatgatgat
gttaaaaagttctggaagcgatattcgaaaggaaattaa

DBGET integrated database retrieval system