KEGG   Tribolium castaneum (red flour beetle): 659807Help
Entry
659807            CDS       T01046                                 

Definition
dual specificity testis-specific protein kinase 2
Orthology
K08842  
testis-specific kinase 2 [EC:2.7.12.1]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Enzymes [BR:tca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     659807
Protein kinases [BR:tca01001]
 Serine/threonine protein kinases: TKL group
  LISK family [OT]
   659807
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG9
AA seq 658 aa AA seqDB search
MMHPSSKNEPRTAKISCIYDTPCDPKATDYEKLYCPNNELSEPPRTRCDRLKTGSSCEAL
KHAVASLHRLDDFHKEKIGSGFFSEVFKVTHRVTGQVMVLKMNLLRSNRRNMLKEVQLMN
KLSHPNILNLMGVCVHEGQLHALTEYINGGSLEQLIQNRNIDLPQPTRVSLARDISYGMS
YLHSKDVFHRDLTSKNVLIKRLESGELQAVVGDFGLASSFPDGKTKLCTVGSPYWMSPEC
LKGQYYDQQSDVFSYGIVLCELIARVEADPDQLPRTDNFGLDYLAFTEMCGQNVVPEFLN
LAFRCCTIDPKSRPTFNEIVQILTEILADLQHHTSDRGEQQAKLASCGAKSEEQLPVLLV
QSSAPQHRKIVHRRSLSEDVSMLSLTMHATPSEKARRHALTMCRQDPHYKPRTSNPFAAL
TQFRGVKKFLGNFSSCCELPSPFIESTESPKSLPGSPTASRKAATTSSSRSPFFVHPFFK
GGSSTNLLELGTTEGPNITLRRRGSCESGFYSSVGECLSPSSLWDSGTAVSSLRSLDELE
PAELQALCKRASSICTDSSEDISSLTGSEWTQDLKPKNISYMVDYFERKGASLRHPGGVR
GGLQLSSRIAALRKSLEKQGAAGAVNSNSLVTPQRHKYNRIVVCEGAVRSKLPLFDKK
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgatgcacccgagcagcaaaaatgagccccgtaccgctaaaatttcgtgcatttacgac
accccctgcgaccccaaagcgaccgactacgagaagctgtactgccccaataacgagctg
tcggagcccccgaggacccgctgtgatagactcaaaactggatcgtcctgcgaggccctg
aagcatgccgtggcatccctccatagactcgacgacttccacaaggaaaaaatcggatcg
gggtttttctcggaggttttcaaggtgacccaccgcgtaaccggtcaagtgatggtgttg
aagatgaacttgttgcgttcgaatcgccgtaacatgttgaaggaggtccaattgatgaat
aaattatcccatccgaatatcctaaatttgatgggtgtatgcgtgcacgaaggtcaatta
catgccctcaccgaatacatcaatggtggttcattagagcaactcatacaaaatagaaac
atcgatttaccacaaccaacaagggtatccttggcaagggatatatcatacggcatgagc
tatcttcattccaaggacgtatttcacagggacttaacaagtaaaaatgtcctaataaag
cgcctggaatcgggcgagctgcaggccgtggtgggcgacttcggcttggcgtcatcgttc
cctgacggcaaaacgaagctgtgtaccgtcggatccccttattggatgtcccccgagtgc
ctgaaaggtcaatactacgaccaacaaagtgatgtatttagttacggaatagtgttatgc
gaactgatagcacgtgtcgaagctgatcccgatcagttgcccagaactgacaatttcggt
ctcgattatttagcgtttaccgaaatgtgtggacagaacgttgtacctgaatttttaaat
ttggcatttcgatgctgcactatcgatccaaaaagtcggccgacattcaacgaaatcgtt
caaatattaaccgaaatcttggccgatctacaacatcatacatccgatcgaggagaacaa
caagccaagttggcaagttgtggcgccaaaagcgaggaacaactgcctgtacttttggta
caatcgtcggcaccacaacacaggaaaattgtccaccggcgatcgttatctgaagacgta
tccatgttgtcgctaacgatgcacgcgacacctagcgagaaagcccgtcgtcacgccttg
acgatgtgccgtcaagacccgcactacaagcctcgtacgagcaatccattcgcggcttta
acccaattccgcggtgttaaaaagttcctcggcaatttttcgtcttgttgcgaattgcca
tctcccttcatcgagtccacagaatcgcccaaatcgctccccggctctccaaccgcctcc
cggaaagcagcgacaacgtcgtcgtctcgttcgcccttcttcgtgcatccctttttcaaa
gggggctccagcacgaacctcctggagttgggaaccaccgaaggccccaacatcacgttg
cgacgtcggggctcctgtgaatcggggttttattcaagcgtgggggaatgtctctctccg
agtagtttatgggacagtgggacagcggttagttcgttgcgctcgcttgatgagttggaa
ccggccgaattgcaggcgttatgtaagagagcgtcgtcaatttgcacagatagcagcgaa
gatatttcgagtctgacgggctccgagtggacgcaggacttgaaaccgaagaatatctcc
tacatggtggactacttcgagcggaagggggccagtctgaggcacccggggggcgttcga
gggggcttacagctcagttcgaggattgcagcgctgcgcaaatcgctggagaagcagggg
gctgccggtgctgttaattcgaattcgcttgtgacgccacagaggcacaagtacaaccgg
attgttgtctgtgaaggtgcagttaggtcaaagttgcccctttttgataaaaagtag

DBGET integrated database retrieval system