KEGG   Tribolium castaneum (red flour beetle): 659809Help
Entry
659809            CDS       T01046                                 

Definition
NADPH--cytochrome P450 reductase-like
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Enzymes [BR:tca01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     659809
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG9
AA seq 680 aa AA seqDB search
MDEAEASLGTQQIPEASESLFSTIDIILLTLLIGGVAWWFLNKQKKKDVAATARSYSIQP
TSMTLQTSSDNSFIKKLKSSGRSLVVFYGSQTGTGEEFAGRLAKEGVRYRLKGMVADPEE
CDMEELVNLKSIPNSLAVFCLATYGEGDPTDNAMEFYEWLQNGDADLSGLNYAVFGLGNK
TYEHYNQVAIYVDKRLEELGATRVFDLGLGDDDANIEDDFITWKDKFWPAVCEHFGIEST
GEDVSMRQYRLQEFKDEVPEKLYTGEMARLHSLKNQRPPFDAKNPFLAKILVNRELHKGN
DRSCMHIEFDIEGSKMRYDAGDHVAVYPINDSDLVEKIGKLTNTDLDTIFTLINTDEESS
KKHPFPCPTTYRTALTHYLDITMNPRTHVLKELSEYCTDPAEKEKLKTMASTSPEGKALY
QQWVNEDNRNIVHILEDMPSCKPKLDHLCELLPRLQPRYYSISSSPKLYPNTVHITAVVV
EYKTPTGRHNKGVCTTWLALKKPAPGQEPPTAPIFIRKSQFRLPTKTQTPIIMIGPGTGL
APFRGFIQERHQAKEEDKAVGETVLYFGCRKKAEDFIYEEELLNYEKSGLLTLHLAFSRD
QAHKVYVSHLLEKNREEVWRIIGENNGHLYICGDAKSMAPEVRNIVMKIIQDKGQMTEQQ
ASAYLKKMETQKRYSADVWS
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atggacgaagcagaagcgagtctcggcacccagcagatccccgaagcctccgagtccctc
ttcagcacaattgacatcatcctgctgacgctcttaatcggcggagtcgcctggtggttc
ctaaacaagcagaagaagaaagatgtggccgccaccgcacgctcatactccatccaaccc
acgtccatgaccctccaaaccagctccgacaactccttcatcaaaaaactcaagtcgtcg
ggacgcagcctggtggtgttctacgggagccagacgggaacgggggaagagttcgccggg
aggctggccaaggagggcgtcaggtaccggctgaaggggatggtggcggaccccgaggag
tgcgacatggaggagctggtgaacttgaaatcgatccccaacagtctggctgtgttttgt
ttggcgacgtacggggaaggtgaccccactgacaatgccatggagttctacgagtggctg
caaaacggcgacgctgatttatcaggcctcaattatgcggtgtttggcttggggaacaaa
acctacgagcactacaaccaagtcgccatctatgttgacaagagactagaggagctgggg
gccacgagagtgtttgatctcggactgggcgacgacgacgccaacattgaagatgacttt
atcacgtggaaggacaagttctggcccgcggtgtgcgaacacttcggcatcgagtcaacc
ggcgaggacgtcagcatgcgccaataccgcctccaggagttcaaagacgaagtcccggag
aagctctacactggtgagatggcgcgcctccactccctcaaaaaccagcggccgcccttc
gacgccaaaaaccccttcctggcgaaaattctggtgaatcgtgaactccacaaaggcaac
gaccggtcctgcatgcacatcgagttcgacatcgaaggctcaaaaatgcgctacgacgcc
ggcgaccacgtcgccgtttacccaatcaacgactccgacctggtcgagaaaatcggcaaa
ctgacaaacacggacctggacaccatcttcacgctcatcaacaccgacgaggagtccagc
aagaagcacccgttcccgtgccccaccacctaccggaccgccctgacccactacctggac
atcaccatgaacccgcgcacccacgtcctgaaggagctgtccgagtactgcaccgaccct
gcggagaaggagaagctgaagaccatggcgagcacgtcccccgagggcaaagccctgtac
cagcagtgggtcaacgaagacaaccgcaacatcgtgcacatcctcgaagacatgccctcg
tgcaagcccaagcttgaccacctttgtgaacttttaccgcgtctccagccacggtattac
tccatttcttcgtcgcctaagctctaccccaacacagtccacatcacggcggtcgtggtg
gagtacaagacgcccacggggcgccacaacaagggcgtgtgcaccacctggctggcgctc
aagaaaccggccccgggacaggagcccccaacagcccccatcttcatccgcaagtcgcag
ttcagactacccaccaaaacgcagacccccatcattatgatcgggccggggacgggtctg
gcgcccttccggggcttcatccaggagcgccaccaggccaaggaggaagacaaggctgtg
ggtgaaacagttctctactttgggtgtcgcaagaaggccgaggattttatctacgaagag
gagttgctcaattacgagaagagcgggctgttgacgctgcatttggcgttttcgcgggac
caggcgcataaagtttacgtttcgcatctgttggagaagaatcgggaggaggtctggagg
atcattggggagaacaatgggcacttgtatatttgcggggacgcgaaatcaatggcaccg
gaagtgcgtaatatcgtcatgaaaattattcaagacaaaggtcagatgaccgagcaacag
gcgtcagcgtatttgaagaaaatggaaacgcagaaacgttattccgccgacgtatggagt
taa

DBGET integrated database retrieval system