KEGG   Tribolium castaneum (red flour beetle): 659919Help
Entry
659919            CDS       T01046                                 

Definition
guanylate kinase-like
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:tca00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG5; LG1=X
AA seq 196 aa AA seqDB search
MSGLRNPRPLVLCGPSGSGKSTLVKKMMADFPDKFGFSISHTTRQPRPGEVHGQHYHFTS
REEMEQAISDGRFIESASFCGNMYGTSKAAVEQVIQEGKVCVLDIDVQGVKQVKKTDLNP
FYVFIKPPSLEELKNRLTARKTESEESLNHRLKVASEEMEYGTSDNFDFIVVNDNLDHAY
AQLKTFVEEKVLKETN
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcttgcggaacccccggcccttggtgctgtgcgggccctcgggctccggcaaa
agcacgctggtgaagaagatgatggccgacttcccggacaagttcgggtttagcatcagt
cacacgacccggcagccccgtccgggggaggtgcacggccagcactaccacttcacctct
cgggaggagatggagcaggccatcagcgacgggaggttcatcgaaagcgccagcttttgc
gggaacatgtacgggacgagcaaagcggcggtggagcaagtgatccaagagggcaaggtc
tgtgtgctggatatcgacgtccagggggtgaagcaggtcaagaagacggacctcaacccc
ttctacgtcttcatcaagccccccagtttggaggagctgaagaacaggctcacggcgcgc
aaaaccgagtcggaggagagtctcaaccataggttgaaagtggccagtgaggaaatggaa
tatgggacttcggataacttcgattttatcgtagttaatgataatttagaccacgcatat
gctcagctaaagacgtttgtggaagaaaaggttttgaaagagacaaattaa

DBGET integrated database retrieval system