KEGG   Tribolium castaneum (red flour beetle): 659954Help
Entry
659954            CDS       T01046                                 

Definition
(RefSeq) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    659954
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    659954
  Amino acid metabolism
   00310 Lysine degradation
    659954
Enzymes [BR:tca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     659954
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG7
AA seq 478 aa AA seqDB search
MAGMLTITSRNVPRTVLRTLNSYLEKCVTEVPPKHRAYHQGLKAIRKAAVKPSHSVFARP
QSICCKQVRYFRSSAALFEEKIVTVPPFADSVSEGDVRWEKKKGDQVAEDEVVLEIETDK
TSVPVPAPANGIIEEMYVEDGATVKAGQNLFKLKLTGDAPVKKAPAEKAAEPAAAPPPPS
PAAAATPPPPPKPAAPAAGGPPPPAPPRPAAPLSSIPVAAIRHAQAIEAATVKVPPQDPT
KEISGTRTEQRVKMNRMRLKIAERLKQAQNVNAMLTTFNEIDMSYIMEFRKANQDAFQKK
YGLKLGFMSAFVKASAYALQDQPVVNAVIDGQEIIYRDYVDISVAVATPKGLVVPVVRNV
ERMSYADIELAINALGEKARKGSLAVEDMDGGTFTISNGGVFGSLLGTPIINPPQSAILG
MHGIFERPVAVKGQVVIRPMMYIALTYDHRLIDGREAVFFLRKIKQAVEDPRVMLAGL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtatgcttacgataacgtctagaaatgtaccacgaacagttttaagaacctta
aacagttatttagaaaaatgtgtgacagaggtacctcccaagcacagagcgtaccatcag
gggttaaaggcgataagaaaagcggccgtgaagcctagtcactcagtatttgcaaggccc
cagtctatttgttgtaaacaagtgaggtatttccggtcttctgccgccctttttgaggag
aaaatcgtaactgtacccccattcgcagactcagtctccgaaggtgatgtaaggtgggaa
aagaaaaaaggcgaccaagtggctgaagatgaggtcgttttggagatcgaaacggacaaa
acctcggttccggtacctgccccagccaatggtattatcgaggaaatgtatgttgaagat
ggtgccactgtgaaagctggccaaaacctcttcaaattgaaacttactggggatgctccg
gttaaaaaagccccagctgagaaggctgccgagccagcggccgctccaccgccaccaagc
cccgctgccgccgccacgccgccgccaccaccaaagcccgcggctccagcggcagggggg
ccgccaccgccggcgcccccgcggccagcagcgcccctcagctcgataccagtggctgcc
ataagacatgcccaggccattgaagctgccactgttaaagtgcccccacaagaccccacc
aaagaaatttcaggaacacgaactgaacaaagagttaagatgaacaggatgcgtttgaag
attgcagagaggttgaaacaagcccagaatgttaatgccatgttaaccactttcaacgag
attgatatgtcatacatcatggagttccgaaaggccaaccaggacgctttccagaagaaa
tacggcctgaagctgggcttcatgtcggcatttgtcaaggcctcggcttacgccctccaa
gaccagcccgttgtgaacgccgtcatcgatggccaggaaatcatctacagagactacgtc
gacatctccgtagccgtggctacacccaagggtctggtcgttcctgtcgtcaggaatgtt
gaaagaatgagttacgcggacatcgaattggccatcaacgcccttggcgaaaaggcgcgg
aaagggagtttggccgtggaagacatggatggaggaactttcacgatcagtaacggtggc
gtgttcggttcgctcctgggaacccccattatcaacccaccgcagtcggctattcttgga
atgcacgggattttcgaaagacctgtggccgttaaaggacaagttgtgattcgccccatg
atgtacatagccctaacgtacgatcacagacttatcgacggacgtgaagcagttttcttc
ctccgaaaaatcaaacaagcagtggaagatccgcgagttatgttagccggtctctaa

DBGET integrated database retrieval system