KEGG   Tribolium castaneum (red flour beetle): 659954Help
Entry
659954            CDS       T01046                                 

Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    659954
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    659954
  Amino acid metabolism
   00310 Lysine degradation
    659954
Enzymes [BR:tca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     659954
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG7
AA seq 478 aa AA seqDB search
MAGMLTITSRNVPRTVLRTLNSYLEKCVTEVPPKHRAYHQGLKAIRKAAVKPSHSVFARP
QSICCKQVRYFRSSAALFEEKIVTVPPFADSVSEGDVRWEKKKGDQVAEDEVVLEIETDK
TSVPVPAPANGIIEEMYVEDGATVKAGQNLFKLKLTGDAPVKKAPAEKAAEPAAAPPPPS
PAAAATPPPPPKPAAPAAGGPPPPAPPRPAAPLSSIPVAAIRHAQAIEAATVKVPPQDPT
KEISGTRTEQRVKMNRMRLKIAERLKQAQNVNAMLTTFNEIDMSYIMEFRKANQDAFQKK
YGLKLGFMSAFVKASAYALQDQPVVNAVIDGQEIIYRDYVDISVAVATPKGLVVPVVRNV
ERMSYADIELAINALGEKARKGSLAVEDMDGGTFTISNGGVFGSLLGTPIINPPQSAILG
MHGIFERPVAVKGQVVIRPMMYIALTYDHRLIDGREAVFFLRKIKQAVEDPRVMLAGL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtatgcttacgataacgtctagaaatgtaccacgaacagttttaagaacctta
aacagttatttagaaaaatgtgtgacagaggtacctcccaagcacagagcgtaccatcag
gggttaaaggcgataagaaaagcggccgtgaagcctagtcactcagtatttgcaaggccc
cagtctatttgttgtaaacaagtgaggtatttccggtcttctgccgccctttttgaggag
aaaatcgtaactgtacccccattcgcagactcagtctccgaaggtgatgtaaggtgggaa
aagaaaaaaggcgaccaagtggctgaagatgaggtcgttttggagatcgaaacggacaaa
acctcggttccggtacctgccccagccaatggtattatcgaggaaatgtatgttgaagat
ggtgccactgtgaaagctggccaaaacctcttcaaattgaaacttactggggatgctccg
gttaaaaaagccccagctgagaaggctgccgagccagcggccgctccaccgccaccaagc
cccgctgccgccgccacgccgccgccaccaccaaagcccgcggctccagcggcagggggg
ccgccaccgccggcgcccccgcggccagcagcgcccctcagctcgataccagtggctgcc
ataagacatgcccaggccattgaagctgccactgttaaagtgcccccacaagaccccacc
aaagaaatttcaggaacacgaactgaacaaagagttaagatgaacaggatgcgtttgaag
attgcagagaggttgaaacaagcccagaatgttaatgccatgttaaccactttcaacgag
attgatatgtcatacatcatggagttccgaaaggccaaccaggacgctttccagaagaaa
tacggcctgaagctgggcttcatgtcggcatttgtcaaggcctcggcttacgccctccaa
gaccagcccgttgtgaacgccgtcatcgatggccaggaaatcatctacagagactacgtc
gacatctccgtagccgtggctacacccaagggtctggtcgttcctgtcgtcaggaatgtt
gaaagaatgagttacgcggacatcgaattggccatcaacgcccttggcgaaaaggcgcgg
aaagggagtttggccgtggaagacatggatggaggaactttcacgatcagtaacggtggc
gtgttcggttcgctcctgggaacccccattatcaacccaccgcagtcggctattcttgga
atgcacgggattttcgaaagacctgtggccgttaaaggacaagttgtgattcgccccatg
atgtacatagccctaacgtacgatcacagacttatcgacggacgtgaagcagttttcttc
ctccgaaaaatcaaacaagcagtggaagatccgcgagttatgttagccggtctctaa

DBGET integrated database retrieval system