KEGG   Tribolium castaneum (red flour beetle): 659954Help
Entry
659954            CDS       T01046                                 

Definition
similar to dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Carbon metabolism
Module
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:tca01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:tca00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:tca00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG7
AA seq 420 aa AA seqDB search
MNCRPQSICCKQVRYFRSSAALFEEKIVTVPPFADSVSEGDVRWEKKKGDQVAEDEVVLE
IETDKTSVPVPAPANGIIEEMYVEDGATVKAGQNLFKLKLTGDAPVKKAPAEKAAEPAAA
PPPPSPAAAATPPPPPKPAAGGPPPPAPPRPAAPLSSIPVAAIRHAQAIEAATVKVPPQD
PTKEISGTRTEQRVKMNRMRLKIAERLKQAQNVNAMLTTFNEIDMSYIMEFRKANQDAFQ
KKYGLKLGFMSAFVKASAYALQDQPVVNAVIDGQEIIYRDYVDISVAVATPKGLVVPVVR
NVERMSYADIELAINALGEKARKGSLAVEDMDGGTFTISNGGVFGSLLGTPIINPPQSAI
LGMHGIFERPVAVKGQVVIRPMMYIALTYDHRLIDGREAVFFLRKIKQAVEDPRVMLAGL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaattgcaggccccagtctatttgttgtaaacaagtgaggtatttccggtcttctgcc
gccctttttgaggagaaaatcgtaactgtacccccattcgcagactcagtctccgaaggt
gatgtaaggtgggaaaagaaaaaaggcgaccaagtggctgaagatgaggtcgttttggag
atcgaaacggacaaaacctcggttccggtacctgccccagccaatggtattatcgaggaa
atgtatgttgaagatggtgccactgtgaaagctggccaaaacctcttcaaattgaaactt
actggggatgctccggttaaaaaagccccagctgagaaggctgccgagccagcggccgct
ccaccgccaccaagccccgctgccgccgccacgccgccgccaccaccaaagcccgcggca
ggggggccgccaccgccggcgcccccgcggccagcagcgcccctcagctcgataccagtg
gctgccataagacatgcccaggccattgaagctgccactgttaaagtgcccccacaagac
cccaccaaagaaatttcaggaacacgaactgaacaaagagttaagatgaacaggatgcgt
ttgaagattgcagagaggttgaaacaagcccagaatgttaatgccatgttaaccactttc
aacgagattgatatgtcatacatcatggagttccgaaaggccaaccaggacgctttccag
aagaaatacggcctgaagctgggcttcatgtcggcatttgtcaaggcctcggcttacgcc
ctccaagaccagcccgttgtgaacgccgtcatcgatggccaggaaatcatctacagagac
tacgtcgacatctccgtagccgtggctacacccaagggtctggtcgttcctgtcgtcagg
aatgttgaaagaatgagttacgcggacatcgaattggccatcaacgcccttggcgaaaag
gcgcggaaagggagtttggccgtggaagacatggatggaggaactttcacgatcagtaac
ggtggcgtgttcggttcgctcctgggaacccccattatcaacccaccgcagtcggctatt
cttggaatgcacgggattttcgaaagacctgtggccgttaaaggacaagttgtgattcgc
cccatgatgtacatagccctaacgtacgatcacagacttatcgacggacgtgaagcagtt
ttcttcctccgaaaaatcaaacaagcagtggaagatccgcgagttatgttagccggtctc
taa

DBGET integrated database retrieval system