KEGG   Tribolium castaneum (red flour beetle): 659956Help
Entry
659956            CDS       T01046                                 

Definition
lysosomal thioesterase PPT2 homolog
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    659956
  Lipid metabolism
   00062 Fatty acid elongation
    659956
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    659956
Enzymes [BR:tca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     659956
Lipid biosynthesis proteins [BR:tca01004]
 Fatty acid synthase
  Component type
   659956
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 285 aa AA seqDB search
MKYLFLLCIICDLFITILSYKPVFLLHGIMTGSASMEIIKGRIEEQHPGTIIYNTNRFSG
WSSLENMWYQVQQLGQDLLNVSSQHPEGIHLLGYSQGALLSRTILQTFNNHNVHNFISLS
GPQAGQYGTNFLHLIFPDLALKSAFELFYSRVGQHTSVGNYWNDPYHQTLYKEYSQYLPF
VNNEIISNRSEEFKKGITKLNAMVLIGGPDDNVITPWESSQFGYFGQNDTVVNLIDRDIY
KDDLIGLKTLDKAGKLKIITVPGVNHFMWHLNTSIVDNYILPYLD
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatctgtttttactttgcattatctgtgatttatttataacaatattgagttat
aagccagtttttttacttcatggaatcatgacaggaagtgctagtatggaaataatcaaa
ggtcggattgaggaacaacaccccggtacaataatttacaacactaatcgattttctggt
tggtcaagtctggaaaacatgtggtatcaagtccagcagcttggccaagatctcctaaac
gtttcaagtcaacatcctgaagggatacacttattaggttattcacaaggggctctcctt
tcacgaacaattctacaaacatttaacaatcacaatgttcataattttatctcactcagt
ggcccccaagccggtcagtatggaacgaattttttacatttgattttcccagacttggca
ctcaaatcagcttttgaattattttactcgagggtaggccaacacacctcagtcggtaat
tactggaacgacccttaccaccaaactttatacaaagaatattcccaatatttaccattc
gtgaacaatgaaattatttcaaacagaagtgaggagttcaagaagggaataactaaactt
aacgcaatggtgctgattgggggccctgatgacaacgtgataaccccctgggagtcaagt
cagtttggatattttggccaaaatgatacagtggtcaacttaatcgatcgtgatatttac
aaggatgatcttattggactgaagactttggataaggctggaaaattaaaaattatcact
gtccctggtgttaaccattttatgtggcatctcaatacctcaatcgtcgacaattatatt
ttaccataccttgattaa

DBGET integrated database retrieval system