KEGG   Tribolium castaneum (red flour beetle): 660035Help
Entry
660035            CDS       T01046                                 

Definition
similar to jitterbug CG30092-PD
Orthology
K04437  
filamin
Organism
tca  Tribolium castaneum (red flour beetle)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG3
AA seq 2797 aa AA seqDB search
MSTSESIGVSAQYCSKAGPSKPNIKTAFLLTIAIHRYHLTQPKHKSRRFHPKLVNSAPME
GKISHSGLLARSPEGHAARGMQIKGNEDVWVEIQANTFRNWVNEHLPQNLRVADLSQDLC
TGVRLCALVEALRGHPLKPAWNKRPANQHHYLENVTTALNAIEQDGVKLVNIGNLDIVNG
NLKLILGLIWSLIVRYQIGRSKFPPRKLMLAWLQAVLPECRVSNLTTDWNSGILLSALVD
YCQPGLFSHWRKLDKHNNIENCRRAMDIAQRELGIPAVLEPEYLASPWLDELSGMTYLSY
FMKPGSPGFHATLRWVNSRLERPVNNFTSDWNDGRVISEVIRSLGGSAPAPEKLRVESQY
WESNLHQAIEAGKRLGVQPILSAKDMADAHVEHLGVMAYAAHFQWIPERPPLHDLISVAL
NSTSGRVGEPTHFQVNLLDSSLAYSNVTVEIRGPDNKVYPVKNLRQGRGVFVPQKVGMHE
IVVKYEEQEVVGGHYFRVLPQLVEVAPPGMAPCALGSLVQVLVNATGAPRREDILVTAYS
PTGRPLNCPLTTIDGTNSATFKPDEAGEWRIEITYQGKQIQGGPFTCSVFDPNGVQVSGL
EGALPLVPHSIDLDCRAVGVPGEVFADIVHDKRSVHCRVEKVNSSKLLYRIHFTPKDVGK
HRVYVYFNGYDVKGSPFMMRVGTQKRSKSSSSPSPNSTYRQSPTSRYSSSSPINHVKNAT
YSNYRQSASPVSSETHKYAQEYHKMSVDKRNSPSFNDRTNSPSYLNRTNSPSYMQRTQSP
SYNRSDSPDYITSRRLNEKRYDTASPSFAKKAEYDSSYTSKMSSMRISESRSPNFLERSS
PDVGYNSRYEKRVTESRSFNNSYDHNDGIDTSPIVKVSAIADQSSARRDSWDAIAKTRNI
LSERSLESVANLTDSQLDADLRRRKVEEHNRMFTQEHNYTSSQKYSNNIDIYGRNSPSTG
HRIGVRNGGASAVKVQPVPDGVLGQPVEFEIDGSGAGSGDLEILVEGGRVTSSVRSLGGQ
RFKAAFTPHQALPHRVDIKFNGETVPGSPWHVNIMSNSNLSVLGETTRLVPANTSAVFEI
ITSTNVAPDDLMVHVIAPSKRSVPARVLPGNRTGVQSVEFVPTEVGTHIIEVTVNGEKLP
SGPLIAKVYDAGLIQVADVSGGVVGQPVQFRVDASQAGEGQLEISINEGEVPNHVQVVGG
GRCLVSFTPEQAKPHLIDIKFNGETVRGCPFVCSVADTSRVTLSLSHLELIPVNQPSSFH
MGVAGGGAAELAVAVRGPVGELPVKVTGDIHSGFTAEFTPTQVGAHQISVDYNGRPVQGT
PFIAKAFDSNKVTVGTVARGTVGRPVTFSVDASEAGEGNLEITISARGLNIPTQVHPQGN
ARFAVSFVPAEACDHVVNVAFNKKPVVGCPLIVSVGGGGNGPSVTLPGPGPVHRPSTLLI
NHPGRLEDIEVNVEGPGGQAVPTQVQSLGNSQFRAEFVPRVVGEHRINVTVSGIPTAGSP
YAAKVYDVQAIKVKETSNGVVGKPVTFLVETSQAGPGNLEVTVNGGRVPTSAQAQGPHTY
AISFTPREATVHSVDLRFNGQDVPGSPFKCNVAPAAKIIGPEALDKVSVGRPCTLVVESP
TPPIVEILGPARRSLPTQITPQAGSPGKFDISFTPIDVGDHSVEVRLPTGHIEGSPFLIK
AYDANRVTVTDITDGVVGKPVSFSINASQAGAGNLEIIVAVGGRNVPNFVQSEGNARFKV
NFKPTEAATHTLSVRFNGQPVPGSPFSCKVSPGNTQPRVPVSGSGIELAAVGHTAEIKIE
GVPTGEPQIVTTAPSGKIIPTKVSHSGDTYIARFTPEVVGRHSVAILINDQHVIGSPFSC
NVYDVNKVIVSGLPGRKNDNLNRILNDLSLNNDLATAEVGKPVTFSVDAAQAGEGTLELV
VSTQHTTIKAEVVACARGLYDVTFVPQTAEDHYVNITFNDMSVVGSPFHCSVIEATQYVQ
IGTISYIDLPSDQHKLEITDNNNHHVKYLVNNSKAEFSLTQTGTYRVQIYRGHEIIATRT
LHVFDTSKIDIINAPEALCHRPAVVGINMNKGGPGKLTASVKIANKDVAHSVRQSPTNPN
MWEIVFHPIHAAPHRVTLFYNNVPKFGVLEVLVKGPGNEPWAGGLGLYQARVGKVTSFHI
DTLGRSAREFDVVISGPGGSAVPVRCYQTKTGKLQAEYTARDIGGHKIEVLHQSKPVSGS
PFHCQAFDPDNVRVVDIPHIQGNVGERVSFNVTTKNSGDADLEVQVTNPIGQTMATQEHL
LEDNLKQISFLPTMAGLYQVSITYGGVSVKGSPLALGVGPIGPTPPPRAVGRGLESGQVG
ERTSFTVSSVIQPRVQIEAVEGTIEAHIQSPKPGEYLVSYTPKWVGTYDIIISIGPNDLP
GSPFRPVIVDPNAVRLIGGWNQFLDDNGRLKLPTKLAFDLSNAGPGNLECKVAGRKVNTE
KSGSRVRFEISGEGFNSGEHDFDIRLANIPLPHAPKTAISSGDQVVLTGRGLANAQCGEP
AVFTIDGSKAGAGNPEVTLHAADSNLPIPVMISLAGEKIWRATYTIPTPGNYLLSVLWAG
RPVKGCPLIVEAKGGADASKVLCSGEGLRQGVVGREIRSWIDTRRAGPGELTAHCTGPRK
VAYCELYDHGDATFTLNVKPQEPGKHALTIKYAGQHVPGSPFTLRVAGAPDASKVRVYGP
GIEHGVLATFQSRFICDTRGAGAGQLTVRVRGPKGAFRVEMQRESQKDRTILCKYDPTEP
GDYRVEVKWAGELVPGSPFPVMIFDTQEELRRYISSL
NT seq 8394 nt NT seq  +upstreamnt  +downstreamnt
atgtccactagtgagagcatcggagtctccgcgcaatactgcagcaaggcgggcccctcc
aaacccaacatcaaaactgctttcctcctcacaatcgccatacacaggtaccaccttacg
caacccaaacacaagtcgcgcagatttcatccgaaactggtaaacagtgcccccatggag
ggaaaaatatcacacagtggcttattggcccggagtccggaaggacacgcggcccgaggc
atgcagatcaaaggcaacgaggatgtgtgggttgaaatccaagccaacactttcaggaat
tgggtgaacgaacacctgccgcaaaatttaagggtggcggacctgtcgcaggacttgtgc
accggagtgaggctgtgcgcgctggtggaggcgctgagggggcatcccctgaaaccggcc
tggaacaaacggccagccaatcagcaccactatctcgaaaacgtcacaacggccctaaac
gccatagagcaggatggagtcaagctggtcaacataggcaatctcgacatcgtcaacggc
aacttgaagctaatcttgggcctgatttggtctttaatcgtgcgctaccaaatcggccgc
tccaaattccctcctcgaaaactaatgctagcctggctccaggccgtccttcccgaatgt
cgcgtaagcaacctcaccacagactggaattccggaattttgctatcggcattagttgac
tattgccagcccggtctgttctcacattggagaaagttagacaaacacaataacattgaa
aattgtcgccgtgccatggatatagcccagcgagaactgggtatccctgccgttcttgaa
ccggaatatctcgcctctccgtggttagacgaactatccggcatgacgtacttatcgtac
ttcatgaagcctggttctccagggtttcacgccactttgcgatgggtcaactcgcgactg
gagaggccagtcaacaacttcacaagcgactggaacgacggcagggtaataagcgaagtg
atccgttcgctgggcggctcagccccagctcccgagaagctccgcgtcgagtcgcaatac
tgggagtccaacctgcaccaagccatcgaagccggcaaacgactaggtgtgcaaccaata
ctatcagccaaggacatggcagacgcacacgtcgagcatttgggagtgatggcatacgcg
gctcacttccagtggatccccgaacggcccccgctgcacgacctcatctccgtcgcgctc
aactcgacctcgggaagggttggagaacccacgcacttccaagtcaatttgctcgactcc
tcgctggcgtactcgaacgtgacggtggagataaggggccctgataacaaagtgtatccg
gtgaagaacctgaggcagggacggggggtcttcgtgccgcagaaggttggtatgcatgag
atcgtcgtcaaatacgaagaacaggaagtcgtcggcggtcattatttccgagttttgccc
caacttgttgaagtagcgccgcccgggatggcgccgtgtgcgttggggtcgctggtccaa
gtcctggtcaatgccacaggggcgccgaggagggaggatattctagtgacggcgtacagc
cccacagggcggccgttgaattgtccattgactaccatcgatgggaccaatagtgctacc
ttcaagccggacgaagccggggaatggaggattgagattacgtatcaaggaaagcaaata
cagggtggtcctttcacatgctcagtcttcgacccgaacggcgtccaagtctccggcctc
gaaggcgccctgcctctcgtaccccacagcatcgacctggactgccgtgctgtcggcgtc
cctggcgaagtcttcgccgacatcgtccacgacaagcgctcggtccactgtcgcgtcgag
aaagtcaactcttcgaagctcctctaccgtatccacttcacccccaaagacgtgggcaag
caccgagtctacgtctacttcaacggctacgacgtcaaaggctccccgttcatgatgcgc
gtcggcacccaaaagcgctccaagtcctccagcagtccgagccccaactccacgtacaga
caaagcccaactagtcgatattcaagttctagtccaatcaaccacgtcaaaaacgcgact
tatagcaattaccgccaaagtgccagtccggtgtcgagtgaaacccacaaatacgcacaa
gagtatcacaaaatgtcggtggataagcgaaattcgccgagtttcaacgaccggacgaac
agtccgagttacctcaaccggactaatagtcccagctacatgcagaggacccagagtccg
agctacaacaggtcggatagtcctgactacatcaccagtcggagactcaacgagaaacgc
tacgacaccgctagtcccagctttgccaagaaggcagagtacgactcgagttacacgtcg
aagatgtcttccatgcgtatttccgagtccaggagtccgaattttttagaacgttctagt
ccagatgttggttataactcacggtacgagaaacgggtcactgaaagtcggtcttttaac
aattcgtatgatcacaacgacggaattgacactagtcccatagtcaaagtgtcggcaatc
gcagaccaatcatccgccagaagagactcctgggatgctattgcaaaaacacgaaatatt
ctatcagagcgaagtcttgaatcagtggccaatttaaccgactcccaactagacgccgac
ctgcgacggagaaaagtggaggaacacaaccgaatgttcacccaagagcacaactacacg
tcctcacagaaatactcgaacaacattgatatttatgggaggaattcaccgtccacagga
cacaggatcggggttagaaacggcggagcgtccgctgttaaagttcagccggtccctgac
ggcgtcctgggacaacccgttgagtttgaaattgatgggagcggtgccggctccggtgat
ttggaaattctggtggaaggtggtcgggtcacgtccagtgttaggagtctgggtggacaa
cggtttaaggccgcttttaccccacaccaagcgctgccgcatcgggtcgatatcaagttt
aacggcgaaacggtgccagggagtccatggcatgttaacatcatgtcgaactcaaatctg
tcagttttgggcgaaaccaccagattggtgccggccaacacttcggccgttttcgaaatc
ataacaagtaccaatgtggcgcccgacgatttgatggtgcatgtgattgcgcccagcaaa
aggtcggtgccggcgagagtgctccccggaaatcgcaccggagttcaaagtgtggagttt
gtgccgacggaggtcgggactcacatcattgaagtcaccgttaacggggaaaagttgccc
tcggggcccttgatcgccaaagtgtacgatgctgggcttattcaagtggccgatgtcagt
ggaggggttgtgggacagcccgtgcaatttcgagttgacgccagccaagccggcgaaggc
cagttggaaatctcaataaatgagggcgaagtcccaaaccacgtccaagtggtgggtggg
ggccgttgcctcgtctccttcacccccgagcaagccaaaccccacttaatcgacatcaaa
ttcaacggagagacggtgcgaggatgccccttcgtgtgctcagtcgctgacacaagccga
gtgactttgagtttgagtcacttggagttaatccccgtcaaccaacccagctcgttccac
atgggggtggccgggggcggcgccgccgagctggcggtggcggtccggggccccgtcggc
gagctccccgtcaaagtcacaggggacatccattcgggcttcaccgccgagttcacccca
acgcaagtgggggcgcaccagatcagcgtcgattacaatggacggccggtccaagggacc
cctttcatagcgaaggcttttgactcgaataaagtcactgtggggacggtggccaggggg
acagtgggccggccggtgactttctccgttgacgccagtgaggctggagaagggaatttg
gagattacgataagtgcgagagggttgaatattcccacgcaagtgcacccccaaggcaat
gcccggtttgcagtgagtttcgtgccagcagaggcttgtgatcacgtggtgaacgttgcg
tttaataagaaacctgttgtgggatgccctttaattgttagtgttggagggggaggaaat
gggccaagtgtcactttgcccggacctggaccggttcatagaccgagcactttgctcatt
aaccatcctggaagacttgaggatattgaggttaatgttgagggccccggcggccaggca
gtcccaactcaagttcaatcccttggaaattcccaattccgagccgagtttgtcccgcga
gttgtcggcgaacaccggatcaacgtcaccgtcagcgggattcccacagctgggagtccc
tacgctgccaaagtctacgacgtgcaagccatcaaagtcaaagagacctccaatggagtg
gtgggcaagccggtcacttttttggtggaaacgagccaagccggccctggcaacctcgaa
gtaacggtgaacgggggcagggtgcccacctcggcccaggcccaggggccccacacctac
gccatctcgttcacgccacgtgaggccactgtgcattcggtggacttgcggttcaacgga
caggacgtccctggaagcccctttaagtgcaatgtggcgcctgcggctaaaatcatcggg
ccagaggcccttgataaggtttcagtggggcggccttgcactctggtggtggaaagtcca
acgccgcccattgtggagattttggggccggctcgaaggtctctaccgactcagattaca
ccgcaagctggttctccgggtaaattcgatatttctttcactccgatcgatgtgggtgac
cacagtgtggaagtaaggcttcccaccggccacattgaggggagcccctttttaattaag
gcctatgacgctaatagagtcactgtaacggatatcacagacggtgttgtgggaaaacct
gtctcttttagtattaatgcatcacaagccggtgctggcaatttggaaattatcgttgct
gtgggtggtagaaacgtcccgaattttgtgcagagtgaaggaaatgccaggtttaaagtt
aattttaaaccgactgaggccgcaacacacacactaagcgttagatttaacggacagccc
gttccgggatcccccttcagctgcaaagtgagtcctggcaacacccaacctcgcgtcccc
gtttccggttcaggtatcgaactggccgcagttggccacaccgctgaaataaaaatcgaa
ggggtaccaaccggcgaaccccaaattgttacaaccgcacccagtggcaaaataatccca
acgaaagtaagccacagcggtgatacttacattgcccgtttcacaccggaagtagtcggc
cgccattcggtagccattttgatcaacgaccaacacgtgattggctcacccttcagctgc
aacgtctatgatgtcaataaagtcatagtttcgggattacccggacgcaaaaatgacaat
ctcaacagaattttaaacgatttgagtttgaacaacgatttagctacggctgaggtcgga
aagcctgtaacgttcagtgtggacgctgcccaagctggggagggtactctggagctggtg
gtgtccacccagcacaccaccatcaaagcggaggtggtggcatgcgctcgggggttgtac
gatgttactttcgtaccccaaactgctgaagatcactatgttaatataactttcaacgac
atgtctgttgttggaagtccgttccattgttcagttattgaagcaactcagtacgtccaa
atcggtaccatttcctacattgacctaccaagcgaccaacacaagctcgaaatcaccgat
aataacaaccaccacgtcaaatatttggtcaacaactccaaagctgagtttagcttgact
cagacagggacctatcgagtacaaatttaccgcggccatgaaatcatcgcaacacgaacc
ctccacgtgttcgacacttccaaaattgatattattaacgcacctgaagccctatgccac
cgcccggccgtcgttggcatcaatatgaacaaaggtgggccgggaaaactgaccgcatct
gtgaaaattgccaacaaagacgttgcccacagtgtgcgccaaagccccaccaaccccaac
atgtgggaaatcgtttttcaccccattcatgcggccccacaccgcgttactctcttttac
aacaatgtgcccaaatttggggtcttggaggtgctcgtgaaagggccggggaatgagcct
tgggcgggaggactgggcttgtatcaagccagggtcgggaaggtcacttcgtttcatatt
gatactcttggcaggagtgcaagggagtttgatgtggttattagcgggccgggagggtcg
gctgtgcctgtcaggtgttaccaaacaaagactgggaagttgcaagctgagtatacggcc
agagatattgggggacacaaaattgaagtgttgcatcagtcgaagccggtcagtggaagt
ccgtttcattgccaggcgtttgatccggataatgttagggttgtggatattccgcacatt
caagggaatgttggggaacgagtgtcttttaatgttacaactaagaattctggcgatgcc
gacttggaagtccaagtaacgaacccgattggccaaacaatggcaacgcaagagcacctc
cttgaagacaatttaaaacaaatttcatttttaccgaccatggctggactttaccaagtc
agtattacatacggaggagtgtctgtgaaaggctcacctttggcccttggtgtgggtcct
attggccctacaccacctcctagagctgtcgggagaggtctagaaagtgggcaagtgggc
gaaaggacttcattcacagtcagtagtgtcatacaaccaagagtacaaatcgaagctgtt
gaagggaccattgaagcacacatacaaagccccaaacctggggaatatctcgtgtcatac
acacccaagtgggttgggacttacgacatcattatcagtattggtcccaatgatctaccg
gggtcaccattccgacctgtaattgttgacccgaatgcagttcggttgattggtggttgg
aaccagtttttggacgataatggaagactgaaattaccaacgaaactagcgtttgatttg
tcaaatgctggacctgggaacctagaatgcaaagttgctggtcggaaggttaatacagaa
aagtctggaagtcgagtcagatttgaaatatccggggaaggtttcaattccggcgaacac
gattttgatattagactagccaacattcccttgccacatgcccccaaaactgcgatctct
tcaggggatcaagtggtgttgacaggccgggggcttgccaatgctcagtgtggagagccg
gctgtttttacaatcgatggctcaaaagccggcgcaggcaaccctgaggtgaccctccac
gccgctgacagcaacctccctatccctgtcatgatcagcctcgctggggaaaaaatctgg
cgggccacctacaccatccccacccccggcaactacctcctctccgtgttatgggcgggg
cggcccgtcaaaggctgccccctcatagtggaggccaaagggggcgccgacgcctccaaa
gtgctctgttcgggagaaggccttcgccaaggtgtggtgggccgtgaaattcgctcctgg
atcgacaccaggcgagccggtcctggagagttaacagctcattgcaccgggccgagaaaa
gtggcttactgcgaactctacgaccacggcgatgccactttcaccctaaatgtcaaacct
caagaacccggaaagcacgcgctgactattaaatatgcgggtcagcatgttccgggctcg
ccgttcactctgagggtggccggggcgcccgatgccagcaaagtgcgagtgtacggtcct
ggaattgagcatggggttttggccactttccagtcacggtttatttgcgatacgagaggg
gctggggctggacagctcaccgtgagggtgagggggcccaagggggcgttcagggttgag
atgcagagggagagtcagaaggataggactattttgtgcaagtatgacccaactgaacct
ggagactaccgtgtggaggttaaatgggcaggagagttggtgccaggctctccgttccct
gttatgatttttgatacgcaagaagaactgagacggtatataagttcgttgtga

DBGET integrated database retrieval system