KEGG   Tribolium castaneum (red flour beetle): 660056Help
Entry
660056            CDS       T01046                                 

Definition
(RefSeq) calcineurin B homologous protein 1
  KO
K17610  calcineurin B homologous protein 1
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Protein phosphatases and associated proteins [BR:tca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     660056
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 SPARC_Ca_bdg EF-hand_5 EF-hand_4 MMgT DIMCO_N
Motif
Other DBs
NCBI-GeneID: 660056
NCBI-ProteinID: XP_971411
UniProt: D6WT98
Position
LG7
AA seq 190 aa AA seqDB search
MGNRSSLLLREEEIAQIQEETGFTPNQIERLYSRFTSLDRGDCGTLSRDDFLRIPELAIN
PLGERIVNSFFQEEGLNDRVNFRQFMRVLAHFRPIKKNKENKLNSREEKLRFAFKMYDLD
NDDMISKEELLAILHMMVGANISEEQLTSIAERTIVEADEDRDQMISFEEFCNALQRTDV
AQKMSIRFLN
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaccgctcgtctctgctgctccgtgaggaggaaatcgcccaaatccaggaggaa
acaggattcacccccaaccaaatcgagcgtctctactcccgtttcacgtccctggaccgt
ggggattgtggcactttgagccgcgacgatttcctccgaattcccgagctcgcaatcaac
cctttgggcgagagaatcgtcaattcgtttttccaggaggaaggcttgaacgatagggtg
aatttcaggcagtttatgcgcgttttggcccactttagacccatcaagaagaacaaagag
aataaactgaactcgagggaggagaagctgagattcgctttcaaaatgtacgaccttgat
aacgacgatatgatctcaaaggaggagcttttggcgatcttgcacatgatggtgggggcc
aacatcagcgaggaacagttgaccagtattgcagagcgcactatcgtggaggctgatgaa
gacagagaccaaatgatttcattcgaggagttttgtaatgcgttacaaaggacggatgtc
gcccaaaaaatgagcattcgcttcctgaactag

DBGET integrated database retrieval system