KEGG   Tribolium castaneum (red flour beetle): 660063Help
Entry
660063            CDS       T01046                                 

Definition
alkaline phosphatase-like
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tca00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG8
AA seq 529 aa AA seqDB search
MRVEGTIFLALVAATLPFLVSGDDWMHPHLPKNPSKRSLENNEENTAAYWTRNGLQAVRE
RIERKRNENMAKNVILFLGDGMSIPTISAARVYLGGEEKSLTFDKFPYTGLSKTYCVDQQ
VADSACSATAYLCGVKANYGTIGVTGDVKRDDCSSMLNSTNHVHSIAHHFQNSGKMTGVV
TTARVTHASPAGTYAHTAERDWESDNDVISANHDPVTCRDIAWQLVHGDTGRGLNVILGG
GRSNFIPQGEKDEDGFEGHRLDKVNLIEQWLVQKKEMGYNAKYVWNREGLLKTDYNQTDY
LLGLFNSDHVTFNLKRDPNREPSLAEMTQAAIKLLDKSQNGYFLFVEGARIDMGHHNAQA
RMALDETIEFSKAVQAAVDLTDESETLIVVTSDHAHTMSYSGYAHRGNDVLGIAGNADDT
LPYTILNYANGPGYKASQGQRYDVSNDDMSNAEYRYPGISPLDAETHGGDDVAIFAQGPW
AHLFTGVMEENVIPYLLAYASCVGNGTTMCDNIKETNSRIMNLVKKQLL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtcgagggtacaatttttttggcacttgttgcggcaacattgccatttcttgtc
tcaggggacgactggatgcacccccacttgcccaaaaaccccagcaaaaggtccctggaa
aacaacgaagaaaacaccgccgcctactggacgcgaaacgggctccaagcggtgcgagaa
agaatcgaaaggaagcgcaacgaaaacatggcaaaaaacgtgatcctcttccttggtgac
ggaatgtcaatccccactatctccgccgccagggtgtacctcgggggcgaagaaaaaagc
ctaacatttgacaaattcccctacactggactgtcaaaaacctactgtgtcgatcaacaa
gtggccgactccgcctgttcggccacagcctacttatgcggcgtcaaggccaactacggc
acaatcggtgtgaccggtgacgtcaaacgtgacgactgttcttccatgttaaattcaacc
aatcacgtccattcaatcgcccaccatttccaaaacagtggaaaaatgacaggagtagtg
accacggcacgtgtgacccacgcctcgcccgccggcacgtacgcacacacggcggaacgt
gattgggagagcgacaatgacgtcatctcggccaatcacgacccggtcacgtgccgcgac
atcgcctggcaattggtccacggcgacacggggcggggcctcaacgtgattttaggaggg
ggaaggtcgaattttatccctcaaggtgaaaaggacgaggacggtttcgaaggacacaga
ctcgacaaagtcaacttgatcgagcaatggctcgtgcagaagaaagagatgggttataac
gccaaatatgtgtggaacagagagggactattaaagaccgactataaccaaaccgactat
cttttgggtttgtttaattcggatcacgtgacgtttaatttgaaacgtgacccgaatcgt
gagccgtcattggcggaaatgacgcaagccgccattaaactattagacaagtcgcaaaat
ggctacttcctgtttgtggaaggcgcaaggatcgacatggggcaccataacgcccaggct
aggatggctctggacgaaacaatcgaattttcaaaagcggtccaagccgccgttgacttg
accgacgaatcggagactttgattgtcgtgacgtcagaccacgcccacacgatgagctac
agcgggtacgcacatcgcggaaatgacgttttaggcattgccggaaatgccgatgacact
ttaccttacacgattttgaattatgctaatgggccagggtataaagccagtcaaggtcag
cggtatgacgtcagcaatgacgacatgtcaaatgccgagtatcgctatccggggatttcc
ccattggacgccgagacgcatggcggcgatgacgtagccatttttgcgcaagggccatgg
gcccaccttttcaccggtgtcatggaggagaacgtcataccctaccttctcgcctatgca
tcttgcgtaggcaatggtactaccatgtgtgacaatatcaaagaaaccaattcgagaata
atgaacttggtcaagaaacaattattatga

DBGET integrated database retrieval system