KEGG   Tribolium castaneum (red flour beetle): 660290Help
Entry
660290            CDS       T01046                                 

Definition
UDP-glucuronosyltransferase 1-7-like
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    660290
   00053 Ascorbate and aldarate metabolism
    660290
   00500 Starch and sucrose metabolism
    660290
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    660290
   00860 Porphyrin and chlorophyll metabolism
    660290
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    660290
   00982 Drug metabolism - cytochrome P450
    660290
   00983 Drug metabolism - other enzymes
    660290
Enzymes [BR:tca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     660290
Glycosyltransferases [BR:tca01003]
 Others
  Hydrophobic molecule
   660290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG4
AA seq 532 aa AA seqDB search
MPPSDKLITCTQDKGIIYAVKCSMLIQVVVLLKILLSVHSYTILALFPHRGKSHANVFLT
LTQALAKKGHEVTAISYFPLKTPLPNYIDITLGNSSSHFIDRINLNDYQGLRTERWFILR
TLNNFSLGMCQQDLSSPSLGDFLKSGPKFDVVLTEYFNCDCFLSVLHKFKSPVIGVSSST
VMHWTNEIFANPTNPAYVPNNLLNFSDRMAFWERVENFVLGLWQTFYYEFFMLPDGEEIA
KRFHNFASLRDIVFNSSLLLVNSHFTLNLPRPLVPAVVEIGGVHIVGVEKLPQNLEKWIN
ESAHGVIYFSLGSMIKGHTFPDEKRSEFLKAFGRLPQRVLWKWENETMSGKPDNVMIQKW
MPQLDILCHPNVKAFISHGGLLGTTEAVHCGVPVVVMPQYGDQFTNARALEANGGGVILH
LSEATEERIYDALKTILDPRFQKQAKELSARFRDRPLPPLETAIYWVEYVARHRGAHHMR
TAAVDMPLYKYLLLDVIAFLVLVAGLLFALFFYATRAILRKLFTKRDKQKTN
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgcccccaagcgataaacttatcacttgcacccaagataagggcattatttatgcagtg
aagtgcagcatgttgatccaagtagtagtgttgttaaaaattctcttgtcggtgcattcc
tacaccatcctcgcactttttccccaccggggcaagagtcacgccaatgttttcctcacc
ctgacccaagctctggcaaaaaagggacacgaagtgactgcaatcagttactttcctttg
aagacacctcttccaaattatatcgacatcactttgggaaactcctcgtctcattttatt
gacaggattaatctaaacgactatcagggtctcaggaccgagagatggtttattcttaga
acactgaacaatttctcgcttggcatgtgtcaacaggatcttagttcgccatcacttggg
gattttctcaaaagtgggccgaagttcgacgttgtcttgactgaatatttcaattgtgat
tgctttttgagcgttttgcataaatttaaaagcccggtgattggggtcagttcgtcgact
gttatgcattggacgaatgagatatttgctaatcccaccaatccggcttacgttccgaat
aatcttctgaatttttccgaccgaatggcattttgggaaagagtcgaaaatttcgtgctg
gggctttggcaaacgttctattacgagttctttatgctgccagatggggaagaaatcgcg
aagcggtttcataatttcgcgtccctcagagacatagtttttaatagcagcttgttgctt
gtgaatagtcatttcaccttgaatctgccacgtccgctagttcctgcggtggttgaaatt
ggcggggttcatattgtgggggtggaaaaattaccacaaaacctcgagaaatggataaac
gaatccgcccacggagttatttacttcagtctgggctcgatgatcaaagggcacacgttt
cccgatgagaaaagaagcgaatttttgaaagctttcggacgtttgccgcagcgagtcctt
tggaaatgggagaacgaaacgatgtcgggaaaaccagacaacgtaatgatccagaagtgg
atgcctcaacttgacattctctgccatccgaacgtgaaagctttcatatctcacggaggg
ctcctggggacgaccgaagctgtccactgcggcgttccggtggtggtgatgccgcagtat
ggcgatcagttcaccaatgcccgagcgctggaagcgaacggcggtggagtgattctgcat
ctgtccgaagctacggaagagagaatctacgacgcgctcaaaacgatcctcgatccgcgg
tttcagaaacaagcgaaggagctttcagcgcgtttcagggaccggccactgccgcccctc
gaaaccgccatttattgggtcgaatatgtcgcacgtcaccgaggagcgcaccatatgcgg
actgcagctgtggacatgcctctctacaaatatctcctcctcgatgtgatcgctttcctc
gtcttggtcgccggcttgctgttcgccctgttcttctacgccactagagccattctcagg
aaattattcacgaaaagagacaaacaaaaaaccaattaa

DBGET integrated database retrieval system