KEGG   Tribolium castaneum (red flour beetle): 660290Help
Entry
660290            CDS       T01046                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 1-7
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00040  Pentose and glucuronate interconversions
tca00053  Ascorbate and aldarate metabolism
tca00830  Retinol metabolism
tca00860  Porphyrin and chlorophyll metabolism
tca00980  Metabolism of xenobiotics by cytochrome P450
tca00982  Drug metabolism - cytochrome P450
tca00983  Drug metabolism - other enzymes
tca01100  Metabolic pathways
Module
tca_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    660290
   00053 Ascorbate and aldarate metabolism
    660290
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    660290
   00860 Porphyrin and chlorophyll metabolism
    660290
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    660290
   00982 Drug metabolism - cytochrome P450
    660290
   00983 Drug metabolism - other enzymes
    660290
Enzymes [BR:tca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     660290
Glycosyltransferases [BR:tca01003]
 Others
  Hydrophobic molecule
   660290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_trans_1_3 Glyco_transf_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 660290
NCBI-ProteinID: XP_008191815
Position
LG4
AA seq 532 aa AA seqDB search
MPPSDKLITCTQDKGIIYAVKCSMLIQVVVLLKILLSVHSYTILALFPHRGKSHANVFLT
LTQALAKKGHEVTAISYFPLKTPLPNYIDITLGNSSSHFIDRINLNDYQGLRTERWFILR
TLNNFSLGMCQQDLSSPSLGDFLKSGPKFDVVLTEYFNCDCFLSVLHKFKSPVIGVSSST
VMHWTNEIFANPTNPAYVPNNLLNFSDRMAFWERVENFVLGLWQTFYYEFFMLPDGEEIA
KRFHNFASLRDIVFNSSLLLVNSHFTLNLPRPLVPAVVEIGGVHIVGVEKLPQNLEKWIN
ESAHGVIYFSLGSMIKGHTFPDEKRSEFLKAFGRLPQRVLWKWENETMSGKPDNVMIQKW
MPQLDILCHPNVKAFISHGGLLGTTEAVHCGVPVVVMPQYGDQFTNARALEANGGGVILH
LSEATEERIYDALKTILDPRFQKQAKELSARFRDRPLPPLETAIYWVEYVARHRGAHHMR
TAAVDMPLYKYLLLDVIAFLVLVAGLLFALFFYATRAILRKLFTKRDKQKTN
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgcccccaagcgataaacttatcacttgcacccaagataagggcattatttatgcagtg
aagtgcagcatgttgatccaagtagtagtgttgttaaaaattctcttgtcggtgcattcc
tacaccatcctcgcactttttccccaccggggcaagagtcacgccaatgttttcctcacc
ctgacccaagctctggcaaaaaagggacacgaagtgactgcaatcagttactttcctttg
aagacacctcttccaaattatatcgacatcactttgggaaactcctcgtctcattttatt
gacaggattaatctaaacgactatcagggtctcaggaccgagagatggtttattcttaga
acactgaacaatttctcgcttggcatgtgtcaacaggatcttagttcgccatcacttggg
gattttctcaaaagtgggccgaagttcgacgttgtcttgactgaatatttcaattgtgat
tgctttttgagcgttttgcataaatttaaaagcccggtgattggggtcagttcgtcgact
gttatgcattggacgaatgagatatttgctaatcccaccaatccggcttacgttccgaat
aatcttctgaatttttccgaccgaatggcattttgggaaagagtcgaaaatttcgtgctg
gggctttggcaaacgttctattacgagttctttatgctgccagatggggaagaaatcgcg
aagcggtttcataatttcgcgtccctcagagacatagtttttaatagcagcttgttgctt
gtgaatagtcatttcaccttgaatctgccacgtccgctagttcctgcggtggttgaaatt
ggcggggttcatattgtgggggtggaaaaattaccacaaaacctcgagaaatggataaac
gaatccgcccacggagttatttacttcagtctgggctcgatgatcaaagggcacacgttt
cccgatgagaaaagaagcgaatttttgaaagctttcggacgtttgccgcagcgagtcctt
tggaaatgggagaacgaaacgatgtcgggaaaaccagacaacgtaatgatccagaagtgg
atgcctcaacttgacattctctgccatccgaacgtgaaagctttcatatctcacggaggg
ctcctggggacgaccgaagctgtccactgcggcgttccggtggtggtgatgccgcagtat
ggcgatcagttcaccaatgcccgagcgctggaagcgaacggcggtggagtgattctgcat
ctgtccgaagctacggaagagagaatctacgacgcgctcaaaacgatcctcgatccgcgg
tttcagaaacaagcgaaggagctttcagcgcgtttcagggaccggccactgccgcccctc
gaaaccgccatttattgggtcgaatatgtcgcacgtcaccgaggagcgcaccatatgcgg
actgcagctgtggacatgcctctctacaaatatctcctcctcgatgtgatcgctttcctc
gtcttggtcgccggcttgctgttcgccctgttcttctacgccactagagccattctcagg
aaattattcacgaaaagagacaaacaaaaaaccaattaa

DBGET integrated database retrieval system