KEGG   Tribolium castaneum (red flour beetle): 660308Help
Entry
660308            CDS       T01046                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    660308
   00052 Galactose metabolism
    660308
   00500 Starch and sucrose metabolism
    660308
   00520 Amino sugar and nucleotide sugar metabolism
    660308
Enzymes [BR:tca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     660308
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG7
AA seq 508 aa AA seqDB search
MVDQEKKVRGHSRASSGSREFLEATKRDALNLLEKELDKLLSTAPDNEKEKIRKEFDGFA
ALFGRFLEETGPSVDWDKIEKLPNDAVRDYSTLETPTADTIHNMLNKLVVVKLNGGLGTS
MGCHGPKSVIAVRNELTFLDLTVQQIEHLNKTYKVNVPLILMNSFNTDEDTQKVIRKYKN
LQVEIHTFNQSCYPRINRDTLMPITKKIDIHNDLESWYPPGHGDFYQSFKNSGLLRKFIQ
EGREYCFISNIDNLGATVDLNILNMVLNPKDKVQHEFVMEVTDKTRADVKGGTLIQYENK
LRLLEIAQVPKEHVDDFKSVKTFKFFNTNNLWAKLDAIERVLAQGSLSLEIIINNKSLNN
GLNVIQLETAVGAAMKSFEAGIGINVPRSRFLPVKKTQDLLLVMSNLYSLKNGSLVMSPQ
RMFPTTPLVKLGDNHFAKVKDFLGRFATIPDLIELDHLTVSGDVTFGRGVSLKGTVIIIA
NHGERIDIPSGANLENKIVSGNMRILDH
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaccaggagaaaaaagtccggggccattcgagggcctccagcggctcgcgcgaa
tttctggaagccaccaaacgggacgccttgaacctcctggaaaaggaactggacaagctt
ctatcaacggcgcccgacaatgaaaaggagaagatccggaaagagttcgacggatttgca
gcactctttggaaggtttctcgaagaaactggaccttctgttgattgggataaaattgag
aagttgcctaatgatgctgttagagattacagtactctggagacgccaactgcagatact
atacacaatatgctcaataaattggtagttgttaagctgaacggagggctcgggacgtcc
atgggctgccacgggcccaaatcggtgatcgcggtcagaaacgaactcactttcctcgac
ttaaccgtgcagcaaatcgaacacttgaacaagacttacaaagttaacgttcctctaata
ctcatgaattcgttcaacacggatgaagacacgcaaaaagtgatccgcaaatacaagaat
cttcaagttgaaattcacacttttaaccagtcgtgttatcccagaatcaatagggatact
ctaatgcctatcacgaagaaaatcgatattcataacgacctggaatcgtggtatcctcca
ggtcacggcgatttttaccaaagtttcaaaaattcaggcctcttgcgcaaattcatacaa
gaagggcgggaatattgctttatttctaacatcgataatctgggagctacagttgacttg
aatattcttaacatggtactgaatccgaaagataaagtccaacatgaattcgttatggaa
gtcaccgataagactagggctgacgtcaagggcggtactttgatccaatacgagaacaaa
ctgcgcttattggaaatcgcccaagtgcccaaagagcacgtcgacgacttcaagtcggtc
aaaacgttcaaatttttcaatacgaataacttgtgggcaaaacttgacgctattgagcga
gtcttagctcagggttcgcttagtcttgagattattatcaataataaaagtctgaacaat
ggtttgaatgtgattcagttggagacggctgttggggcggcgatgaaatcgtttgaggca
ggcattggcataaatgtgccgcggagtagatttttgccggtgaaaaaaacacaggacttg
cttctagtcatgagtaatttgtacagtttgaaaaatgggtcgttggtgatgtcgccacaa
aggatgttccccactacgccactggttaagttaggggataatcatttcgcgaaagtgaag
gactttttggggcgctttgcgacgattcccgatttgatcgagttggaccatttgaccgtt
tcgggggatgttacgtttggcaggggcgtctcgttgaagggtactgtaattataatcgcg
aatcacggagaacggatcgatattccgtcaggtgccaatttagaaaataagatagtgtcc
ggtaatatgcggattctggatcattga

DBGET integrated database retrieval system