KEGG   Tribolium castaneum (red flour beetle): 660308Help
Entry
660308            CDS       T01046                                 

Definition
similar to CG4347-PA, isoform A
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:tca00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tca00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tca00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tca00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG7
AA seq 480 aa AA seqDB search
MFEMVRGHSRASSGSREFLEATKRDALNLLEKELDKLLSTAPDNEKEKIRKEFDGFAALF
GRFLEETGPSVDWDKIEKLPNDAVRDYRLGTSMGCHGPKSVIAVRNELTFLDLTVQQIEH
LNKTYKVNVPLILMNSFNTDEDTQKVIRKYKNLQVEIHTFNQSCYPRINRDTLMPITKKI
DIHNDLESWYPPGHGDFYQSFKNSGLLRKFIQEGREYCFISNIDNLGATVDLNILNMVLN
PKDKVQHEFVMEVTDKTRADVKGGTLIQYENKLRLLEIAQVPKEHVDDFKSVKTFKFFNT
NNLWAKLDAIERVLAQGSLSLEIIINNKSLNNGLNVIQLETAVGAAMKSFEAGIGINVPR
SRFLPVKKTQDLLLVMSNLYSLKNGSLVMSPQRMFPTTPLVKLGDNHFAKVKDFLGRFAT
IPDLIELDHLTVSGDVTFGRGVSLKGTVIIIANHGERIDIPSGANLENKIVSGNMRILDH
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaaatggtccggggccattcgagggcctccagcggctcgcgcgaatttctggaa
gccaccaaacgggacgccttgaacctcctggaaaaggaactggacaagcttctatcaacg
gcgcccgacaatgaaaaggagaagatccggaaagagttcgacggatttgcagcactcttt
ggaaggtttctcgaagaaactggaccttctgttgattgggataaaattgagaagttgcct
aatgatgctgttagagattacaggctcgggacgtccatgggctgccacgggcccaaatcg
gtgatcgcggtcagaaacgaactcactttcctcgacttaaccgtgcagcaaatcgaacac
ttgaacaagacttacaaagttaacgttcctctaatactcatgaattcgttcaacacggat
gaagacacgcaaaaagtgatccgcaaatacaagaatcttcaagttgaaattcacactttt
aaccagtcgtgttatcccagaatcaatagggatactctaatgcctatcacgaagaaaatc
gatattcataacgacctggaatcgtggtatcctccaggtcacggcgatttttaccaaagt
ttcaaaaattcaggcctcttgcgcaaattcatacaagaagggcgggaatattgctttatt
tctaacatcgataatctgggagctacagttgacttgaatattcttaacatggtactgaat
ccgaaagataaagtccaacatgaattcgttatggaagtcaccgataagactagggctgac
gtcaagggcggtactttgatccaatacgagaacaaactgcgcttattggaaatcgcccaa
gtgcccaaagagcacgtcgacgacttcaagtcggtcaaaacgttcaaatttttcaatacg
aataacttgtgggcaaaacttgacgctattgagcgagtcttagctcagggttcgcttagt
cttgagattattatcaataataaaagtctgaacaatggtttgaatgtgattcagttggag
acggctgttggggcggcgatgaaatcgtttgaggcaggcattggcataaatgtgccgcgg
agtagatttttgccggtgaaaaaaacacaggacttgcttctagtcatgagtaatttgtac
agtttgaaaaatgggtcgttggtgatgtcgccacaaaggatgttccccactacgccactg
gttaagttaggggataatcatttcgcgaaagtgaaggactttttggggcgctttgcgacg
attcccgatttgatcgagttggaccatttgaccgtttcgggggatgttacgtttggcagg
ggcgtctcgttgaagggtactgtaattataatcgcgaatcacggagaacggatcgatatt
ccgtcaggtgccaatttagaaaataagatagtgtccggtaatatgcggattctggatcat
tga

DBGET integrated database retrieval system