KEGG   Tribolium castaneum (red flour beetle): 660355Help
Entry
660355            CDS       T01046                                 

Definition
AGAP007393-PB-like
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tca00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    660355
Enzymes [BR:tca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     660355
Exosome [BR:tca04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   660355
  Exosomal proteins of colorectal cancer cells
   660355
  Exosomal proteins of bladder cancer cells
   660355
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG5; LG1=X
AA seq 492 aa AA seqDB search
MFLQKIFVLCLFYCACFAKEEDVLEFSDSDFESRVAEHETALVMFYAPWCGHCKKLKPEY
AKAAEDLIRNDPPIALVKVDCTEAGKETCNKHGVSGYPTLKIFRNGEFSQEYGGPREAGG
IVKYMKAQVGPSSKELTSVQDLEKFLKAENDVSVVGFFEKESDLKTAFLKLADKLREKVR
FAHSTYKPVLEKQGVSDGIVLFRPQHLHNKFEDDSVVYSGGAVTGEIQDFINKNYHGLVG
HRKSDNRNDFQNPLVVSYYGVDYVKNPKGTNYWRNRVLKVAKQHKDKINFAVSAKDDFQY
ELNEYGIDYVKEDKPVVLARDAKNQKFIMKDPFSIEALDSFVQDLLAGKLEPYLKSEPIP
ENNDGPVTVAVAKNFDEVVLNNGKDTLIEFYAPWCTHCKKLAPVFDELGEKMKNEDVAIV
KMDATANDVPQPFDVRGFPTLYWAAKDSKDSPVRYEGGREVDDFVKYIAKHATSELKGYD
RKGNPKAEKTEL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgtttttgcaaaaaatattcgtgttgtgtcttttctactgtgcgtgttttgcgaaagaa
gaggacgttttggagtttagtgacagcgattttgagagccgagttgccgaacatgaaact
gcactcgtcatgttttatgccccttggtgcggccactgtaagaaactgaagcccgagtac
gcgaaagccgcagaggacttgatccgcaacgaccccccgattgctctggtcaaagttgac
tgtaccgaggcagggaaagagacttgcaacaagcacggggtcagcgggtaccccaccttg
aagatcttccgcaacggggagttctcgcaggagtatgggggcccgcgcgaggccgggggc
attgtcaagtacatgaaggcgcaagtgggccccagctccaaggagctgaccagcgtccag
gaccttgagaagttcctcaaggccgagaacgatgtctccgttgtgggcttcttcgagaag
gagtccgatctcaagaccgcttttctcaaactcgccgataaattgagggaaaaagtcagg
tttgcgcattccacctacaagcccgtgctggaaaagcaaggcgttagtgacggcattgtg
ctattccgtccccaacacttgcacaacaagtttgaagatgacagcgtggtctacagtgga
ggggccgtcactggggaaatacaggactttattaacaaaaactaccatggcttggtggga
catcgcaaatctgataacaggaatgacttccagaatcctctagtggtttcttattacggt
gttgattacgttaaaaatcccaaaggcacgaactactggcgtaacagggttttgaaagtt
gccaaacaacacaaggataagatcaattttgctgtcagcgctaaagatgacttccaatac
gaattaaacgaatacggtattgactatgtcaaggaggataaacctgttgttttagccaga
gatgccaaaaaccaaaagttcatcatgaaggatcccttctctattgaggccttggacagc
ttcgtgcaagacctgcttgccggaaagctggagccttatctgaagagcgagcccatccct
gagaacaacgacggccccgtaacagtcgccgtggcgaaaaactttgatgaagttgtgctt
aataacggcaaagacactctgatcgagttctacgccccttggtgtactcactgtaagaag
cttgcccctgtctttgacgagctcggtgaaaaaatgaaaaacgaggatgtggcaattgtt
aaaatggacgcaacggctaatgatgttccgcaaccgtttgatgttcgcggtttcccgact
ctttattgggccgccaaggattcgaaagacagtccagtccgttatgagggtggacgggaa
gttgacgatttcgtcaaatacatcgctaaacatgccacatctgagcttaagggttatgac
agaaagggaaatcctaaagcggaaaagactgaactttaa

DBGET integrated database retrieval system