KEGG   Tribolium castaneum (red flour beetle): 660355Help
Entry
660355            CDS       T01046                                 

Definition
AGAP007393-PB-like
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:tca04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG5; LG1=X
AA seq 492 aa AA seqDB search
MFLQKIFVLCLFYCACFAKEEDVLEFSDSDFESRVAEHETALVMFYAPWCGHCKKLKPEY
AKAAEDLIRNDPPIALVKVDCTEAGKETCNKHGVSGYPTLKIFRNGEFSQEYGGPREAGG
IVKYMKAQVGPSSKELTSVQDLEKFLKAENDVSVVGFFEKESDLKTAFLKLADKLREKVR
FAHSTYKPVLEKQGVSDGIVLFRPQHLHNKFEDDSVVYSGGAVTGEIQDFINKNYHGLVG
HRKSDNRNDFQNPLVVSYYGVDYVKNPKGTNYWRNRVLKVAKQHKDKINFAVSAKDDFQY
ELNEYGIDYVKEDKPVVLARDAKNQKFIMKDPFSIEALDSFVQDLLAGKLEPYLKSEPIP
ENNDGPVTVAVAKNFDEVVLNNGKDTLIEFYAPWCTHCKKLAPVFDELGEKMKNEDVAIV
KMDATANDVPQPFDVRGFPTLYWAAKDSKDSPVRYEGGREVDDFVKYIAKHATSELKGYD
RKGNPKAEKTEL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgtttttgcaaaaaatattcgtgttgtgtcttttctactgtgcgtgttttgcgaaagaa
gaggacgttttggagtttagtgacagcgattttgagagccgagttgccgaacatgaaact
gcactcgtcatgttttatgccccttggtgcggccactgtaagaaactgaagcccgagtac
gcgaaagccgcagaggacttgatccgcaacgaccccccgattgctctggtcaaagttgac
tgtaccgaggcagggaaagagacttgcaacaagcacggggtcagcgggtaccccaccttg
aagatcttccgcaacggggagttctcgcaggagtatgggggcccgcgcgaggccgggggc
attgtcaagtacatgaaggcgcaagtgggccccagctccaaggagctgaccagcgtccag
gaccttgagaagttcctcaaggccgagaacgatgtctccgttgtgggcttcttcgagaag
gagtccgatctcaagaccgcttttctcaaactcgccgataaattgagggaaaaagtcagg
tttgcgcattccacctacaagcccgtgctggaaaagcaaggcgttagtgacggcattgtg
ctattccgtccccaacacttgcacaacaagtttgaagatgacagcgtggtctacagtgga
ggggccgtcactggggaaatacaggactttattaacaaaaactaccatggcttggtggga
catcgcaaatctgataacaggaatgacttccagaatcctctagtggtttcttattacggt
gttgattacgttaaaaatcccaaaggcacgaactactggcgtaacagggttttgaaagtt
gccaaacaacacaaggataagatcaattttgctgtcagcgctaaagatgacttccaatac
gaattaaacgaatacggtattgactatgtcaaggaggataaacctgttgttttagccaga
gatgccaaaaaccaaaagttcatcatgaaggatcccttctctattgaggccttggacagc
ttcgtgcaagacctgcttgccggaaagctggagccttatctgaagagcgagcccatccct
gagaacaacgacggccccgtaacagtcgccgtggcgaaaaactttgatgaagttgtgctt
aataacggcaaagacactctgatcgagttctacgccccttggtgtactcactgtaagaag
cttgcccctgtctttgacgagctcggtgaaaaaatgaaaaacgaggatgtggcaattgtt
aaaatggacgcaacggctaatgatgttccgcaaccgtttgatgttcgcggtttcccgact
ctttattgggccgccaaggattcgaaagacagtccagtccgttatgagggtggacgggaa
gttgacgatttcgtcaaatacatcgctaaacatgccacatctgagcttaagggttatgac
agaaagggaaatcctaaagcggaaaagactgaactttaa

DBGET integrated database retrieval system