KEGG   Tribolium castaneum (red flour beetle): 660369Help
Entry
660369            CDS       T01046                                 

Definition
single-strand selective monofunctional uracil DNA glycosylase-like
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:tca00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    660369
Enzymes [BR:tca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     660369
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG7
AA seq 269 aa AA seqDB search
MLKRKLSKPSLDNPLKIARADFAQKFLDIQLELNTALKPLRFKPPVAYVYNPVEYAFKAN
ESYVRKYCQGPKKLLFLGMNPGPFGMCQTGVPFGEIKSVRDWLEIEEEVGKPEKECPQRP
VLGFACTRSEVSGDRLWNVLKKLCGSPENFFKNCFIYNYCPIAMLRSDGGNLTPRDIKDT
QVLEEICDRHYFKIIELLQPEIIIGIGEYAEKRSLATLKNNNSNIRVIRLPHPSPRSKNN
QNWAEKAETFFKNHDLLKYMTDGAPTDQN
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagcgcaagctgtccaagccgtcccttgataacccccttaaaatcgcacgtgcc
gactttgcccaaaaattcctggacatccagctcgaactcaacacagctctcaagcccctc
cggttcaagccgccggtggcgtacgtctacaaccccgtagagtacgccttcaaggcgaac
gaaagctacgtgcgcaagtactgccagggccccaaaaaactgctctttttgggcatgaat
cccggccccttcggcatgtgccagacgggggtgcctttcggcgagatcaagtcggtgcgc
gattggttggaaatcgaggaagaagtcggtaagccggagaaagagtgcccccagcgcccc
gttctgggcttcgcctgcacccgctcggaagtcagcggggaccggctctggaacgtgctg
aaaaagctgtgtggcagtcccgagaattttttcaagaattgtttcatttataactattgt
ccgatcgctatgttgaggagcgatgggggcaacttgactccgagggacatcaaggacacc
caagtcttggaggaaatctgcgaccgccactactttaaaatcatagaattgcttcagcct
gaaataattatcgggatcggggagtatgcagagaagcggtctttggccactttgaagaac
aacaacagcaacatccgggtcatcaggttgccccacccgagcccccgctcgaaaaacaac
caaaactgggccgaaaaggccgaaacttttttcaaaaaccacgacttgctgaaatacatg
actgatggagcccctactgaccaaaactga

DBGET integrated database retrieval system