KEGG   Tribolium castaneum (red flour beetle): 660433Help
Entry
660433            CDS       T01046                                 

Definition
cyclohex-1-ene-1-carboxyl-CoA hydratase, putative-like
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Class
Metabolism; Overview; Carbon metabolism [PATH:tca01200]
Metabolism; Overview; Fatty acid metabolism [PATH:tca01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:tca00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:tca00650]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:tca00062]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:tca00071]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:tca00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:tca00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:tca00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:tca00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG8
AA seq 295 aa AA seqDB search
MAAKSLARFVVSRISTPASNKAFLNNPNIKFYSVQKNFEFIKTHKAGARNNVGVITLNRP
KALNALCNGLMQEVADALDVFEKDNDVGAIIITGSEKAFAAGADIKEMQNNTYSQCVRGN
FLAHWNRVSESVKPVIAAVNGYALGGGCELAMMCDIIYAGENAKFGQPEILIGTIPGAGG
TQRLTRVVGKSKAMEMVLTGDQVPAHEAEKMGLVSKVFPVEKLMDETVKLAEKIAKNSHL
VNGMCKESVNTAYETTLREGLHFEKRMFHGTFATKDRKEGMTAFIEKRAPNFTNE
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgaaaagtttggctcggtttgtggtctccagaatttccacccccgcctccaac
aaggcattccttaacaaccccaacatcaaattctacagcgttcaaaaaaacttcgaattt
attaaaacgcacaaagctggggcccgcaacaatgtgggggtgattactctgaaccggcca
aaggcccttaatgccctttgcaacggcttgatgcaggaagttgccgacgctttggacgtg
tttgagaaggacaacgacgtgggggctatcataatcaccggtagcgaaaaggcctttgct
gcaggtgccgacatcaaagaaatgcaaaacaacacttattcgcaatgcgttcggggcaac
tttttggcccattggaaccgcgtctctgagagcgtgaagccggtgattgctgccgtcaac
ggctacgctctggggggcggttgcgagctggccatgatgtgcgacatcatctacgcaggc
gagaatgccaagtttgggcaaccggagatcttgattgggaccattccgggggctgggggc
acccagaggttgacgagggttgtggggaagtccaaggctatggagatggtgctcacgggg
gatcaagtgccggcgcacgaggccgagaagatgggtctggtcagtaaagtcttcccggtt
gagaaactgatggacgaaacggtcaaactagcggagaaaattgcgaaaaattcgcaccta
gttaacggaatgtgcaaggagtcggtcaatacagcgtacgaaacgacgctcagagagggg
ctccacttcgagaaacggatgttccacgggaccttcgctactaaagaccgcaaagaagga
atgactgcttttattgagaaacgggccccgaatttcacaaatgaataa

DBGET integrated database retrieval system