KEGG   Tribolium castaneum (red flour beetle): 660433Help
Entry
660433            CDS       T01046                                 

Definition
enoyl-CoA hydratase, mitochondrial
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    660433
   01212 Fatty acid metabolism
    660433
  Carbohydrate metabolism
   00640 Propanoate metabolism
    660433
   00650 Butanoate metabolism
    660433
  Lipid metabolism
   00062 Fatty acid elongation
    660433
   00071 Fatty acid degradation
    660433
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    660433
   00310 Lysine degradation
    660433
   00380 Tryptophan metabolism
    660433
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    660433
Enzymes [BR:tca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     660433
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG8
AA seq 325 aa AA seqDB search
MTNFAVYRVADKQAKTLNRFNKFLSINTVTMAAKSLARFVVSRISTPASNKAFLNNPNIK
FYSVQKNFEFIKTHKAGARNNVGVITLNRPKALNALCNGLMQEVADALDVFEKDNDVGAI
IITGSEKAFAAGADIKEMQNNTYSQCVRGNFLAHWNRVSESVKPVIAAVNGYALGGGCEL
AMMCDIIYAGENAKFGQPEILIGTIPGAGGTQRLTRVVGKSKAMEMVLTGDQVPAHEAEK
MGLVSKVFPVEKLMDETVKLAEKIAKNSHLVNGMCKESVNTAYETTLREGLHFEKRMFHG
TFATKDRKEGMTAFIEKRAPNFTNE
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaccaactttgctgtttaccgggttgctgataaacaggcaaagactttgaaccggttt
aacaaatttttatctattaacacagtgacaatggcagcgaaaagtttggctcggtttgtg
gtctccagaatttccacccccgcctccaacaaggcattccttaacaaccccaacatcaaa
ttctacagcgttcaaaaaaacttcgaatttattaaaacgcacaaagctggggcccgcaac
aatgtgggggtgattactctgaaccggccaaaggcccttaatgccctttgcaacggcttg
atgcaggaagttgccgacgctttggacgtgtttgagaaggacaacgacgtgggggctatc
ataatcaccggtagcgaaaaggcctttgctgcaggtgccgacatcaaagaaatgcaaaac
aacacttattcgcaatgcgttcggggcaactttttggcccattggaaccgcgtctctgag
agcgtgaagccggtgattgctgccgtcaacggctacgctctggggggcggttgcgagctg
gccatgatgtgcgacatcatctacgcaggcgagaatgccaagtttgggcaaccggagatc
ttgattgggaccattccgggggctgggggcacccagaggttgacgagggttgtggggaag
tccaaggctatggagatggtgctcacgggggatcaagtgccggcgcacgaggccgagaag
atgggtctggtcagtaaagtcttcccggttgagaaactgatggacgaaacggtcaaacta
gcggagaaaattgcgaaaaattcgcacctagttaacggaatgtgcaaggagtcggtcaat
acagcgtacgaaacgacgctcagagaggggctccacttcgagaaacggatgttccacggg
accttcgctactaaagaccgcaaagaaggaatgactgcttttattgagaaacgggccccg
aatttcacaaatgaataa

DBGET integrated database retrieval system