KEGG   Tribolium castaneum (red flour beetle): 660499Help
Entry
660499            CDS       T01046                                 

Definition
serine/threonine-protein kinase mTOR
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:tca00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    660499
Protein kinases [BR:tca01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   660499
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG8
AA seq 2400 aa AA seqDB search
MSTLAMQQFVAGLKSRNPDVRQKTARELSLYVKSELREATPDEITNFLDEFNHHIFEMVS
SNDPNEKKGGILAIVCLIGVDFGNMTTRISRFANYLRNLLPSSDVSVMESVAKTMGRLAL
VSGSKASEYVEFEVKRAFEWLSGDRIEGKRQAAVLVLKELALTMPTYFYQHVSQFFDLIF
FAIQDPKPAIRESAVEALRAALVVTAQRETAKQNQKPQWYKQCYDESVKMLSVERGERMK
EERVHGFLLILNELVRCSNAEWERKCKSLLERTDTKQPVETSFNFTKSRFVFSVSRRIPQ
YQAVSLAPSQIAIIESQSCRGLVSEKFDYICLDVLAQRLSRSSHIQQSFLTILPRLAAFD
RENYVKQHLSPVMNHIFNILKSREKERAKAFVTIGLIAIAVESDIEPYIERIMEIIRMYL
PRADILGRKRSPIDSSIFNCVTFLAHALKNHSKMDIPNLLEPMLATGLTASLTICFRELS
RKVPEHKERISLGLLKMLSYILLNKPLVHPGMPRHLTGTVMSLAIPEVNDVQIIVLALKT
LGTFDFEGQRLLPFVHRCANHFLIHDNNEIRLEAVRTTCRLLRHAIHSTAKNSSDTVTKT
VAAVLHRLLSVGLTDTDPNVRYGVLISLDRTFDNHLAQAESLSALFLALQDEMFEIREVA
LFTIGRLSAMNPAYVMPSLRKTLVQFLSELEHSGSGRNKEQGARMLDHLVVSAPRMIRPY
MEPILKVLVPKLRDPEPNPGVVLSVLLTIGDLAEVSSGGTELQEWMQELMGILLEMLGDA
SAPEKRGAALCTLGQLVGVTGHVIQPYTEYPILLDVLLNFLKTEQQSYIRRETIRVLGLL
GALDPYKHKINRGEIDYYPEAPVLIPMTDKGEDLNADLTSSEMLVNMSSSTLEEYYLAIA
IATLMRIIKDPTLAQHHTMVVQAVTFIFKSLGIKCVPYISQVLPSLLHVVRTADVNFKEF
LFQQLAQLIYIVKQHIRNYLDDICLLIKEFWTPNSTIQGTLILLVEHIAVALGAQFKVYL
PKMLPHILRVLNHDTSKERLYTIKLLEALHNFGNNLDEYMHLILPPIVRLFDAQECPIVV
SKKALETIDQLAEIIDFSDFISRIVHPLVRTIDNCPELRPTAMETLCSLMQQLGRKFSIF
VPLVQKVMTKHKIQHSKFDTLVSKIQYETTLAEDVDFPMPRSKTTGKNRDPAMPADSGMI
QRLKVSESNLQQAWTPVRRVSKDDWLEWLRRLSIELLKQSPIPALRSCLTLAQTYSQLPR
DLFNAAFVSCWSELSENMQNELISCLEQALTVPDVPEITQTILNLAEFMEHCDKGPLPLD
SHILGHHAMHCRAYAKALHYKEEEFQRGASSQVVEALISINNKLQQKEAAEGLLQYVMQR
EMQVQVRWYEKLHNWEKALRLYTEKLEGDEADQEACLGKMRCLEALGEWGELHQVVEKSF
SLLNDDSKQKASRLAAAASFGLHDYRSMETYVNVIPRDTQEGAFYRAILAIHKEDYEVAQ
RFIDSARDLLDNELTAMAGESYQRAYGAMVMVQMLSELEEVMQYRLVPERRPTLKAMWWQ
RLQSGQKLVEDWQRIIQVHSLVLTPQEDKRTWVKYASLCRKSGSLMLSQKTLVMLLGYDP
SERPDAPLPKNQPHITLAYAKHLWVAQEKQKAFQKLSQFVADYSQNEPNDDVTVEEKKRL
LARCYLKLGAWHEALEGINETSIPFILKCYKQATEHDPQWYKAWHAWAYMNFETVLYYTR
QEDKTHYTVLAVQGFFKSINLSKGSSLQDTLRLLTLWFDYGDWPEVYDAIVEGIRLVEKN
TWLQVIPQLIARIDTTALVSKLINHLLVDIGKTHPQALVYPLTVATKSNSIRRRNAANSI
LKSMSEHSPTLVSQAMMASEELIRVAILWHEIWHEGLEEASRLYFGERNVKGMLRILEPL
HAMMERGPQTLKETSFNQTYGRDLNEAQDWCQRYKLSSNIRDLNQAWDLYYHVFRRISRQ
LPQLTSLELQYVSPNLLVCQDLELAVPGSYCPGQPIVRIANFNRSLEVITSKQRPRKLVI
RGSNGKDYMFLLKGHEDLRQDERVMQLFGLVNTLLMKDPDTFRRNLTIQRYAVIPLSTNS
GLIGWLPHCDTLHTLIRDYRDKKKILLNIEHRIMLRMAPDYDHLTVMQKMEVFEHALEHT
HGDDLARLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKIL
HIDFGDCFEVAMTREKFPEKIPFRLTRMLINAMEVTGIEGTYRRTCESVMSMLHRNKDSL
MAVLEAFVYDPLLNWRLMDIEVRNLPMNSDSMSTSCSQKQGSSESLNVPKREMIMEDNEP
QHEVNARAVIIINRVRDKLTGNDFATEEPLTIPKQVDLLIQQATSNENLSQCYIGWCPFW
NT seq 7203 nt NT seq  +upstreamnt  +downstreamnt
atgtccactttggccatgcaacaattcgttgcggggttgaaatcccgcaaccccgacgtt
cgtcaaaaaaccgcacgagaattaagcttgtacgtaaaaagcgagcttcgcgaagccacc
cccgacgaaataacaaacttccttgacgaattcaaccaccacatcttcgaaatggtctcg
agcaacgaccccaacgagaaaaaaggcggaattttggcgattgtatgtttgattggagtc
gatttcgggaacatgaccacacgtatatcacgcttcgccaattatttacgcaacttgttg
ccctcgagcgacgtgagcgtcatggagtcggtggcgaagacaatggggcgcttggcgctg
gtttcaggctcgaaagcctccgaatacgtcgagtttgaagttaagagggcctttgagtgg
ctcagtggcgaccggattgaagggaagcgacaagctgccgttttagtcttgaaagagttg
gcactaactatgccgacgtatttctaccaacatgtgtcgcaatttttcgatctgattttt
ttcgcgatacaggaccccaaacctgccattagggagagcgctgtggaggctttgagggcc
gctttggtcgtcacagcgcaacgagagaccgccaaacagaaccaaaagccacaatggtac
aaacaatgttacgacgaatccgtgaaaatgctctcggtggaaagaggcgaacgcatgaaa
gaggagcgcgtccacggctttctcctcattctcaacgaactggtgcgttgctcaaacgcc
gaatgggaacgcaaatgcaaaagtttgctcgaacgcactgacaccaaacaaccggtcgag
accagcttcaattttactaaatctcgcttcgttttttcggtctctcgacgcatcccccaa
taccaagctgtgtctttggcaccctctcaaatcgcaatcatagaatcccaaagttgccga
ggcctcgtttccgagaaattcgactacatttgtttagacgtcctggctcagagactctcc
cgttcgtctcacatccaacaaagttttctcacgattttaccccgattggctgcttttgac
cgcgaaaactacgtcaagcagcacttaagccccgtcatgaaccacatcttcaacattttg
aagagtcgggaaaaggagagagctaaggcttttgtgactattggcttaattgcgatcgct
gtcgagagcgacattgagccgtacattgaacgtattatggaaataattcgcatgtatttg
ccccgagccgatattttggggcgcaagcggagccccatcgactcctcaattttcaactgt
gtcactttcctagcccacgccctcaaaaaccactcaaaaatggacatcccgaacctcctg
gaaccaatgctagcaacgggattaaccgcatccctcacgatatgtttccgggaattatcc
cgaaaagtcccggaacataaagaacgaatcagtctcgggttattaaaaatgctgagttat
attctcctgaataaaccactagttcatcccgggatgccccgccacttgaccggaaccgta
atgagtcttgcaataccagaagtcaacgatgtgcaaatcatagttttggccctcaaaaca
ctcggaacgtttgactttgagggccagagactcctcccttttgtccaccgctgcgccaat
catttcctcatccatgacaataacgaaatccgattggaggctgtcagaaccacgtgtcgg
ctcctccgacatgctattcactccacagcgaaaaactcgtcggatacggtcaccaaaacc
gtagctgctgttttacatcgtttgttaagtgttggtttgaccgataccgacccaaatgtc
cggtacggagtcttgatttcgctcgatcgtacgtttgataatcatttagcacaagctgag
tcgctcagtgcgctgtttctggcgttgcaagacgaaatgtttgaaatacgcgaagttgca
ctgtttacaatcgggcgcttgagtgcgatgaatccggcatatgtcatgccctcgttgagg
aaaactttagtgcagtttttatccgaattggaacattcgggcagtgggaggaataaggaa
caaggggcgaggatgttagatcatttggttgtgagcgccccgaggatgataaggccctac
atggagcccattttgaaggtcctggtgcccaaactgcgcgaccccgagccaaaccccggc
gtcgtgctttccgtcctgctcacaatcggcgatttggccgaggtgagcagcggaggcacc
gaactgcaagaatggatgcaagaactgatgggtattttactcgaaatgttgggcgacgct
tccgcccccgaaaaacggggcgccgccttatgcaccttgggccagttggttggagtgacc
ggtcacgtaatccaaccctacaccgaatatccaatactgctcgacgtcctcctcaatttc
ctcaaaaccgaacaacagtcctacattcggcgagaaacaatccgcgttttggggctgttg
ggggctttggatccgtacaaacataaaataaatcggggggagattgattattatcccgaa
gcgcccgttttgataccgatgacggataaaggggaggatttgaacgcggatttgacgtcg
agcgaaatgctggttaatatgagttcgagcactttggaggagtactatttggcgatagct
atagccactttgatgcggattattaaggatccgacgctggcacaacaccatacaatggtg
gtgcaagcagttactttcatttttaaaagtttggggattaagtgtgtgccgtatatatcg
caagttttgcccagtcttttgcacgtagtacggacagccgacgttaactttaaggaattc
ctcttccaacagttggcacaactaatctacatcgtcaagcaacacattcgtaactacttg
gacgacatttgcctactaatcaaagaattttggaccccgaacagtacgattcaagggact
ttgatccttttagttgaacacatcgcagtggcgttgggggcgcaatttaaggtttattta
ccgaaaatgttgccccatatcttacgcgtgttgaaccacgacacgtccaaggaacgactc
tacactatcaaattattggaagcgttacacaatttcggtaacaatttggacgaatatatg
cacttgattttgccccccattgtccggttattcgacgctcaggagtgtccaatagtcgtg
tcgaaaaaagccctcgagactatcgaccaattggccgaaattatcgacttttcggacttt
atctcacgcattgtccaccccttggttcgaacaattgataactgtcccgaattgagaccc
acagccatggaaactttatgttcactcatgcaacaattggggcgaaaattctcaattttc
gtacctttggtacagaaagtgatgaccaaacataagatacaacacagtaaattcgatact
ttagtttcgaaaatccaatacgagacaacactggccgaagacgttgatttcccaatgccg
agatccaaaacaaccgggaaaaatcgagacccagcgatgcctgccgatagtggaatgatt
caaagactcaaagtttcggaatccaacctacaacaggcctggacccctgtccgaagagtc
tcgaaagacgattggttggaatggctaagacgcctcagtatcgaactattaaaacagtca
ccaattccagcattacgttcgtgccttactttagcacagacgtattcgcaactgccacgt
gatttattcaacgcagcgttcgtaagttgttggtccgaattgagcgaaaacatgcagaat
gaactgatcagttgtctcgagcaagctttgactgtgccggacgttccggaaataactcaa
actattttgaatttggccgaatttatggaacattgcgacaaggggcctttgcccctcgat
agccacattctggggcaccatgcgatgcattgccgggcgtacgccaaagccttgcattat
aaggaagaggagtttcaaaggggggcgagcagtcaggttgtcgaagcactcatttcgatc
aataataagttgcaacaaaaggaggcggctgaagggttgttacaatacgtcatgcagagg
gaaatgcaagtgcaggtcaggtggtacgagaagttgcacaattgggagaaggccctgagg
ttgtatactgagaaactggaaggggacgaggcggaccaagaggcttgtttgggcaaaatg
agatgtctcgaagcgttgggcgaatggggcgaactgcaccaagtcgtcgagaaaagtttc
agtttactaaatgacgacagcaaacaaaaggcgagtcggctagcggctgcggcctccttc
ggtttgcacgattacaggtcaatggaaacttacgttaatgtaattccaagggatacgcaa
gagggtgcgttctaccgtgcaattttggcaatacataaagaggattacgaagtggcccaa
agattcatcgattcagctcgcgatttactcgataatgaattaactgcgatggctggtgag
tcctaccaaagggcctacggggccatggtcatggtacaaatgttatccgagttggaagaa
gtaatgcagtatcggttagtaccagaacggaggcccactttaaaagccatgtggtggcaa
aggctccaatcgggccaaaaactggtcgaagactggcaaagaatcatccaagtccattcc
ttggtcttgaccccacaagaagacaaacgaacgtgggtgaaatacgcgtcattgtgtcgc
aagagcggttcattaatgctatcgcaaaaaaccctagtcatgttactcggttacgaccca
agcgaacgtcccgacgcccccttgcccaaaaaccagcctcacatcacactagcctacgcc
aaacatttatgggtggcacaggaaaaacaaaaagcgttccaaaaactatcacaattcgtc
gctgactattcgcaaaacgagccaaacgacgacgtgacagttgaagagaaaaaaagactc
ctggctaggtgttacctcaaactgggggcctggcatgaggcacttgaaggcatcaacgaa
acctccatacctttcattttgaagtgttacaaacaagcgactgaacacgaccctcaatgg
tacaaggcatggcacgcttgggcctatatgaatttcgaaacggtcttgtattacacgaga
caggaggacaagacgcactatacagtcttagccgttcagggatttttcaaatcgattaat
ttatctaaaggaagttcattgcaagacactttacgtttattaacactgtggttcgattac
ggcgattggcccgaagtttacgatgccatagtcgaaggcattcgtttagtcgagaaaaac
acgtggcttcaagtaattccgcaattaatcgcgcgaattgacacaacggcgttagtatcg
aaattaatcaatcatctattggttgatattggaaaaacgcatccacaagccctagtctat
ccgttaaccgtcgcaacaaaaagtaattcaatcagacgtagaaatgcagctaatagtatt
ttaaaatcgatgagtgaacattcccctacgttggtaagtcaggccatgatggcctcagaa
gaattgatccgagtggcaattttgtggcacgaaatctggcacgagggactagaagaagcc
tcaagattgtatttcggcgaacgtaacgttaaaggaatgttgcgaattctcgaaccgttg
catgcgatgatggaaagggggccccagacgttgaaagagacgagttttaatcagacgtac
ggcagggatctgaacgaggcgcaagactggtgccaaagatacaagctttcgagcaacatt
agagacctgaaccaggcgtgggacctctactaccacgttttccgccgcatttcgcgtcaa
ttaccgcaactcacctccctcgaattacaatacgtatcgccaaatttgctagtttgtcaa
gacttagagttggcagtgcctggtagctactgtccaggacagccaatcgtacgcattgcc
aattttaaccgatctctcgaagtaattacctcaaaacagcggccccgaaaactagtaatt
cgtggaagcaacggcaaagactacatgtttttacttaaaggtcacgaggatctgagacaa
gacgagcgtgttatgcaactgttcggtttagttaatactttactaatgaaagacccggat
acgttcaggcggaatttgacgatacagcggtatgcggtgattcccctgagtacgaattcg
ggtctgattgggtggttaccgcactgtgatacgctgcacactttaatacgggattataga
gacaagaagaagattttgttgaatattgagcataggattatgttacggatggcgccggat
tatgatcatttaaccgtgatgcagaaaatggaagtttttgagcacgcacttgagcacaca
catggtgacgatttagcgcggttgttgtggctgaaaagcccctcgtctgaggtttggttt
gaccggagaacgaactacacgcggtctttagctgtgatgtcaatggttgggtatattttg
gggttgggggatcgccacccctccaatttaatgttggacagactgagcggcaaaatcctg
catatagatttcggcgattgcttcgaagtggcaatgactagggaaaaattcccggaaaag
atccccttccgtttgactaggatgctaataaacgccatggaagtgacagggattgaaggc
acgtacagacggacttgtgagtcggtcatgtccatgttacaccgaaataaagacagtctg
atggcggtgcttgaagcctttgtttatgaccccctgcttaattggcgattgatggatatt
gaggtgcggaacttgccgatgaacagcgattcaatgtcgacgagttgttcccaaaaacag
ggctcatccgaatcgctcaatgttccgaaacgcgagatgataatggaagataacgaaccg
caacacgaagttaatgccagggcggttattatcatcaatcgagttagagataaactgacc
gggaacgatttcgctacggaggaacctttgactattcctaagcaagtcgatctgttaata
caacaagcgacaagtaacgagaacttgtcacagtgttacataggctggtgccccttttgg
taa

DBGET integrated database retrieval system