KEGG   Tribolium castaneum (red flour beetle): 660706Help
Entry
660706            CDS       T01046                                 

Definition
ubiquitin carboxyl-terminal hydrolase 35
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.4.19.12]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Enzymes [BR:tca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     660706
Peptidases [BR:tca01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   660706
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG3
AA seq 668 aa AA seqDB search
MAVKQKVVECVAQSAEARLQLILRTLQDLTAQGLQDKKCANIVSLLGTIHVPTDPSDYKQ
FIGSIKSVQEILTKECMKNDLVYLTLRSLYHEISTSQKPLSPAMSIVLTLIQVDYIPTAV
DWILQTGYSPENHKKALMTLCNWLPKWTWTENLGRLVLTFMQGLEAQQQLEIVFEVTEAT
IEPLFRLLILPEHRKSVGPIVKYMLFSMLSQSNPVSFDKVVPHVGSVVAYLYKEKSDSSL
EYFGDIVKVCFLLMDHFSDYSNRYVQLKKDLEQHLPAANCIENGPSNSVATVYSASGKVG
LNNLGNTCYMNSVLQALFMTKPFRNEILLYNKDMTSLLSKLQTLFALLQHSKRASISPHD
ISNLARPPGFLPGHQHDSSEFLGYLLDVLHEQEKTAVCGNGTKADHVPPSYNTIVQSAFG
GRTVSVSRCGECDTKSERVDNFWELQLSFPNTTDNQSVQTLLNYYLQPEKLSGDNQYHCE
VCDCLTDGERVTCIEEAPPRLILTLKHFRYDQASQQRTKLLQSIKLDNHVQLDTGLYVLY
AAVVHCGSSVDSGHYYTFARDGDEWFKFNDCSVMRTMAEELCSLKPPETPYILFYSRQDC
SDPEALPRTVLSQRLQLVINNDHTEFELEKRRRPIKTYNSKQNRNDEPPPPGCGGPGFSS
NSSNMYVC
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgaagcaaaaggtggtggaatgcgtggcccagagcgcggaggcgcgcctccag
ctcatcctgcgcaccctgcaggacctcacggcccaggggctccaggacaagaagtgcgcc
aacatcgtcagcctcctggggaccatccacgtgcccacggaccccagcgactacaagcag
ttcatcgggagcattaagagcgtccaggagatcctcaccaaagaatgcatgaagaacgac
ttggtctacctgaccttgaggtcgctttaccacgaaatctccacgtctcagaagccgctc
tcgccggccatgtccatagttttgacccttatccaagtcgattatatcccgacggccgtg
gactggatcctccaaacggggtattcccccgaaaaccacaaaaaagccctcatgacgctg
tgtaattggctgccgaaatggacctggacggagaacctcggccggttggtcctcaccttc
atgcagggcctggaggcccagcaacagctcgagatcgtgttcgaggtcacggaggccacg
attgagccccttttcaggctgttgattttgcccgagcaccgcaaaagcgtgggccccatt
gtcaagtacatgctgttctccatgttgtcgcaaagcaaccccgtgtccttcgacaaggtc
gtcccccacgtggggagcgtcgtcgcctacttgtacaaagaaaagtccgattctagtctt
gaatatttcggcgacatcgtcaaagtgtgttttctgttaatggaccacttctccgactat
tcaaatcgctacgtccagttgaagaaggacctggagcagcatcttcctgcggcgaattgt
atcgagaacgggccgtcgaattccgtggcgaccgtttattcagcgtcggggaaggtgggg
ttgaacaacctggggaacacctgttacatgaacagtgtcctccaggcgttgtttatgacg
aagccgttccgcaatgagattcttttgtataataaggatatgacgtcgttgttgtccaag
ttgcagacgctgtttgcgctgttgcaacactcgaagagggcttccatctcgccgcatgat
atttcgaatttggcgaggccgcccgggtttttgccagggcatcagcatgacagttcggag
tttttggggtatttgttggatgttttgcacgagcaggagaagacggccgtttgtgggaat
ggtaccaaagcagaccatgtgcccccctcatacaacaccatagtccagtcagccttcggc
ggtcgcacggtgtcggtttcgcgttgcggcgaatgcgacacaaaaagcgaacgcgtcgac
aacttctgggagctgcaactctccttccccaacaccaccgacaatcagtccgtgcagacc
ctcctcaactactacctccaaccggagaagctcagcggcgacaaccaataccactgcgag
gtgtgcgactgtctcaccgacggcgagcgcgtcacctgcatcgaagaggctcccccacgt
ctcatcctcaccctgaagcacttccgctacgaccaggcctcccagcagcgcaccaaactc
ctccagagcatcaaactcgacaatcacgtgcagctcgacaccggcctctacgtgctctac
gcggcggtggtccactgcggctccagtgtggactcggggcactattacacgttcgcacga
gacggagacgagtggttcaagttcaacgattgttccgttatgaggactatggcggaggaa
ctttgcagtttgaagccgccagaaacgccgtatattttgttttatagtcggcaggactgc
tcggatcccgaggcgctgccgaggactgtcttgtcgcagagattacagttagtgattaat
aatgatcacactgagttcgagcttgagaagagaaggaggccgatcaagacgtacaacagc
aaacaaaatcggaacgatgaaccgccgcctccggggtgtggagggcctgggttttctagt
aattcatctaatatgtatgtatgctaa

DBGET integrated database retrieval system