KEGG   Tribolium castaneum (red flour beetle): 660753Help
Entry
660753            CDS       T01046                                 

Definition
similar to CG9008 CG9008-PA
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    660753
Enzymes [BR:tca01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     660753
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG1=X
AA seq 308 aa AA seqDB search
MAIAEHNQVREQQNNAGGSRVGPVATETSVMAATSVVVLDRGNNTTCTINLHGATVVSWR
VNNQEQLFVSKQAVFDGKKAIRGGIPFVFPQFGPWNYGPQHGFARIVRWNLEKPPERLAS
GDIEAIFSLIDSDFTRAVWSYPFQLTYRLILREKELHSNIAVYNPSKESTFSFNLLLHTY
FKVPDVRRCQITGLQGCTYLDKTTNEGALYQETRDVVTIGEWTDRIYQNTPHEHIITNVV
SGRKMRIQKCNFPDTVIWNPWVEHAKEMNDFGDDEYPNMVCVESGHVSSPVILLPGMGFE
ASQILQVM
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcgatagccgaacacaaccaagtgcgggaacagcaaaacaacgcgggaggatcgcgc
gttgggccggtggccacagaaacatcggtcatggccgctacaagtgttgtggtgctcgac
aggggcaacaacaccacctgtaccattaatttacacggtgccactgttgtctcctggaga
gtcaacaaccaggagcaactattcgttagtaaacaagcagtattcgacggcaaaaaagcc
ataaggggcgggatccctttcgttttccctcaattcggcccctggaattacggtcctcag
cacggttttgccagaattgtgcgttggaatcttgagaaacctccagagagattagccagt
ggcgatattgaggctatcttttccctcatagattccgattttacccgcgccgtttggagc
tacccattccagttgacgtaccgactaatcctgcgtgagaaggagttacattccaatata
gccgtgtacaacccaagtaaagaatcgacgtttagctttaacttgttgttgcacacgtat
tttaaagttcctgacgtgcgtcgttgccaaataacaggtctacagggttgcacatacctc
gataagacaaccaacgaaggagctctctatcaggaaacccgcgacgtcgtaacaatcgga
gaatggactgatagaatttatcaaaatacaccacacgaacatataataacaaacgttgtc
tcagggcgtaaaatgcgcatacaaaagtgcaattttcccgataccgtcatctggaatcct
tgggtcgaacatgccaaagagatgaacgatttcggtgacgacgaatatccaaacatggtt
tgtgtcgaatcgggacacgtatcgagtcctgttattttattgcctggcatgggttttgaa
gccagccagattttgcaagtaatgtga

DBGET integrated database retrieval system