KEGG   Tribolium castaneum (red flour beetle): 660754Help
Entry
660754            CDS       T01046                                 

Definition
protein disulfide-isomerase A6
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tca00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    660754
Enzymes [BR:tca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     660754
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG1=X
AA seq 430 aa AA seqDB search
MNRLLVFPVLTLVLASALALYPSSSNVIDLTTSNFDKVLKGDEVWIVEFFAPWCGHCQAL
VPEYTKAAAALKGVVKVGAVNADEYKELGGRYGVRGFPTIKIFGANKDKPEDYNGARTAQ
GLVDAALQAVKSKVKASLGGGSSGSGQSHDTKDVIELTDSNFDKQVLHSEDMWLVEFFAP
WCGHCKNLAPHWAKAATELKGKVKLGALDATVHQAQASKYGVQGYPTIKFFAPGKKTSDS
VSDYDGGRTASDIVTWALEKLAENVPAPEVAQIIDQNMFKEACDQKSLCVVALLPHILDC
QSDCRNNYINILKELGEKYKKKMWGWVWSEAGAQLELENALDIGGFGYPAMAVINPRKMK
YSILRGSFSRDGINEFLRDLSYGRGNTSPVKGDKLPKIVSIEPWDGKDGELPPEEDIDLS
DVDLDSKDEL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaataggctgcttgttttcccggtgctaacccttgtgctggcaagtgcgttggctctc
tacccctcaagctcaaacgtaatcgacttaacgacctcgaattttgataaagtacttaaa
ggggatgaagtatggatagttgagttttttgccccttggtgtgggcattgtcaagccttg
gttcccgaatacacgaaagcggccgccgctctcaagggcgtagttaaagtaggagcagtc
aacgcggatgaatacaaggaacttggggggcgttatggtgttaggggtttcccaacgatc
aaaatttttggggccaataaggacaaaccagaggactacaacggcgcaaggacggctcaa
ggactcgtagacgcggccttgcaagccgttaaatccaaggtcaaggccagccttggcgga
ggctcctcaggctcgggacaaagtcacgacactaaagacgtgatcgaactgactgatagt
aattttgataaacaagttttacactcggaagacatgtggcttgtcgaatttttcgcccct
tggtgcggacattgtaaaaatctcgcgccccattgggccaaagccgcgactgaattgaaa
ggcaaggtcaaacttggggctcttgatgcgaccgttcaccaagcgcaagcttccaaatac
ggagttcagggttaccccacaattaagttctttgcgcctggaaagaagacttccgattcg
gtttccgattacgacggtggcaggaccgccagtgatatcgttacctgggccttggaaaag
ctggcagagaatgtgccagcgccagaagtcgcgcaaatcattgatcaaaatatgttcaaa
gaggcttgtgatcaaaagtcgttgtgcgtcgtggcccttcttccacatattctagattgc
cagtccgactgtaggaacaactatatcaacattttgaaagagttgggggagaaatataag
aagaagatgtgggggtgggtttggtccgaagccggtgcacagttggaacttgaaaatgct
ttagatattggtggttttggatatcccgcaatggctgttattaatccaaggaaaatgaaa
tattccattcttaggggttcattttcacgtgacggaattaatgaattcttgagggatctg
tcctatggacgtggcaatacttctccagtcaaaggtgataaacttccaaagatcgtttcc
attgaaccgtgggacgggaaagacggggaacttcctccagaagaggatattgatctgtcc
gatgttgacttggacagcaaagacgaactttaa

DBGET integrated database retrieval system