KEGG   Tribolium castaneum (red flour beetle): 660754Help
Entry
660754            CDS       T01046                                 

Definition
similar to protein disulfide-isomerase A6
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:tca04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG1=X
AA seq 433 aa AA seqDB search
MNRLLVFPVLTLVLASALALYPSSSNVIDLTTSNFDKVLKGDEVWIVEFFAPWCGHCQAL
VPEYTKAAAALKGVVKVGAVNADEYKELGGRYGVRGFPTIKIFGANKDKPEDYNGARTAQ
GLVDAALQAVKSKVKASLGGGSSGSGQVRVSHDTKDVIELTDSNFDKQVLHSEDMWLVEF
FAPWCGHCKNLAPHWAKAATELKGKVKLGALDATVHQAQASKYGVQGYPTIKFFAPGKKT
SDSVSDYDGGRTASDIVTWALEKLAENVPAPEVAQIIDQNMFKEACDQKSLCVVALLPHI
LDCQSDCRNNYINILKELGEKYKKKMWGWVWSEAGAQLELENALDIGGFGYPAMAVINPR
KMKYSILRGSFSRDGINEFLRDLSYGRGNTSPVKGDKLPKIVSIEPWDGKDGELPPEEDI
DLSDVDLDSKDEL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaataggctgcttgttttcccggtgctaacccttgtgctggcaagtgcgttggctctc
tacccctcaagctcaaacgtaatcgacttaacgacctcgaattttgataaagtacttaaa
ggggatgaagtatggatagttgagttttttgccccttggtgtgggcattgtcaagccttg
gttcccgaatacacgaaagcggccgccgctctcaagggcgtagttaaagtaggagcagtc
aacgcggatgaatacaaggaacttggggggcgttatggtgttaggggtttcccaacgatc
aaaatttttggggccaataaggacaaaccagaggactacaacggcgcaaggacggctcaa
ggactcgtagacgcggccttgcaagccgttaaatccaaggtcaaggccagccttggcgga
ggctcctcaggctcgggacaagtacgagtgagtcacgacactaaagacgtgatcgaactg
actgatagtaattttgataaacaagttttacactcggaagacatgtggcttgtcgaattt
ttcgccccttggtgcggacattgtaaaaatctcgcgccccattgggccaaagccgcgact
gaattgaaaggcaaggtcaaacttggggctcttgatgcgaccgttcaccaagcgcaagct
tccaaatacggagttcagggttaccccacaattaagttctttgcgcctggaaagaagact
tccgattcggtttccgattacgacggtggcaggaccgccagtgatatcgttacctgggcc
ttggaaaagctggcagagaatgtgccagcgccagaagtcgcgcaaatcattgatcaaaat
atgttcaaagaggcttgtgatcaaaagtcgttgtgcgtcgtggcccttcttccacatatt
ctagattgccagtccgactgtaggaacaactatatcaacattttgaaagagttgggggag
aaatataagaagaagatgtgggggtgggtttggtccgaagccggtgcacagttggaactt
gaaaatgctttagatattggtggttttggatatcccgcaatggctgttattaatccaagg
aaaatgaaatattccattcttaggggttcattttcacgtgacggaattaatgaattcttg
agggatctgtcctatggacgtggcaatacttctccagtcaaaggtgataaacttccaaag
atcgtttccattgaaccgtgggacgggaaagacggggaacttcctccagaagaggatatt
gatctgtccgatgttgacttggacagcaaagacgaactttaa

DBGET integrated database retrieval system