KEGG   Tribolium castaneum (red flour beetle): 660758Help
Entry
660758            CDS       T01046                                 

Definition
NADH-cytochrome b5 reductase 2
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    660758
Enzymes [BR:tca01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     660758
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG2
AA seq 321 aa AA seqDB search
MLDNKINILNRVPQNHRQLVLPIALGVGVIITSVLIYHFYKTSKPSKSKGKKKILLEDPQ
AKYSLPLIEKEEISHDTRRFRFGLPTKEHVLGLPIGQHIHLSAKIGDDLIIRSYTPVSSD
DDHGFVDLVVKVYFKKVHPRFPDGGKMTQHLESLKIGDTIEVRGPSGRLQYQGHGTFSIK
KLRKDPPQIVTVNKVSMIAGGTGITPMLQLIRHITKDPSDKTKLKLIFANQTEKDILVRK
ELEEVAKEHPDQFELWYTLDTPPENWKYSSGFINENMIKDHLFPPSNDNIVLMCGPPPMI
NYACNPSLEKLKYDKDLCFAY
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacaataaaatcaatattttgaaccgagtccctcaaaaccaccgccaattggtt
ctaccaatagccctaggggtcggcgtcatcatcacaagtgtattaatttatcacttctac
aaaacatcaaaaccatcaaaatcaaaaggcaaaaagaagattttacttgaggaccctcaa
gcgaaatattcgcttcctttgattgaaaaggaagaaatcagtcatgatacccgcagattt
aggtttgggttgcccacaaaagagcacgttttggggcttcccattggtcaacatattcat
ttgtctgcaaaaatcggtgatgacttaataatccggtcatacacccccgtatcttcagac
gatgaccatggatttgttgacttagtggtcaaggtgtacttcaaaaaagtccacccccga
tttcccgatgggggcaaaatgacgcaacacctcgaaagtttgaaaatcggtgataccatc
gaagttagaggaccatctggacggttacagtaccaaggacatgggaccttttccattaaa
aaactacgcaaagacccaccacaaatcgttacagttaacaaagtttctatgattgcgggt
ggtactggcattacacccatgctacaacttatcagacacatcacaaaagacccaagtgat
aagacaaaactaaaactgatttttgcaaatcagactgagaaagacattttggttcgaaag
gaactggaggaagtggcgaaggagcatccagatcagtttgaactgtggtacactctcgat
acacctccagaaaattggaaatacagttcaggctttatcaatgaaaatatgatcaaggac
catctcttccccccaagcaatgataacattgtactcatgtgtggacccccacctatgatt
aattacgcctgtaatcccagtttggagaagttgaaatatgataaagatctgtgcttcgct
tattaa

DBGET integrated database retrieval system