KEGG   Tribolium castaneum (red flour beetle): 660758Help
Entry
660758            CDS       T01046                                 

Definition
CG5946 CG5946-PB-like
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Amino sugar and nucleotide sugar metabolism
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tca00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG2
AA seq 310 aa AA seqDB search
MPEEEKNQVLPIALGVGVIITSVLIYHFYKTSKPSKSKGKKKILLEDPQAKYSLPLIEKE
EISHDTRRFRFGLPTKEHVLGLPIGQHIHLSAKIGDDLIIRSYTPVSSDDDHGFVDLVVK
VYFKKVHPRFPDGGKMTQHLESLKIGDTIEVRGPSGRLQYQGHGTFSIKKLRKDPPQIVT
VNKVSMIAGGTGITPMLQLIRHITKDPSDKTKLKLIFANQTEKDILVRKELEEVAKEHPD
QFELWYTLDTPPENWKYSSGFINENMIKDHLFPPSNDNIVLMCGPPPMINYACNPSLEKL
KYDKDLCFAY
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgccggaagaagaaaaaaaccaggttctaccaatagccctaggggtcggcgtcatcatc
acaagtgtattaatttatcacttctacaaaacatcaaaaccatcaaaatcaaaaggcaaa
aagaagattttacttgaggaccctcaagcgaaatattcgcttcctttgattgaaaaggaa
gaaatcagtcatgatacccgcagatttaggtttgggttgcccacaaaagagcacgttttg
gggcttcccattggtcaacatattcatttgtctgcaaaaatcggtgatgacttaataatc
cggtcatacacccccgtatcttcagacgatgaccatggatttgttgacttagtggtcaag
gtgtacttcaaaaaagtccacccccgatttcccgatgggggcaaaatgacgcaacacctc
gaaagtttgaaaatcggtgataccatcgaagttagaggaccatctggacggttacagtac
caaggacatgggaccttttccattaaaaaactacgcaaagacccaccacaaatcgttaca
gttaacaaagtttctatgattgcgggtggtactggcattacacccatgctacaacttatc
agacacatcacaaaagacccaagtgataagacaaaactaaaactgatttttgcaaatcag
actgagaaagacattttggttcgaaaggaactggaggaagtggcgaaggagcatccagat
cagtttgaactgtggtacactctcgatacacctccagaaaattggaaatacagttcaggc
tttatcaatgaaaatatgatcaaggaccatctcttccccccaagcaatgataacattgta
ctcatgtgtggacccccacctatgattaattacgcctgtaatcccagtttggagaagttg
aaatatgataaagatctgtgcttcgcttattaa

DBGET integrated database retrieval system