KEGG   Tribolium castaneum (red flour beetle): 660781Help
Entry
660781            CDS       T01046                                 

Definition
similar to ubiquitin specific protease 20
Orthology
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.1.2.15]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Enzymes [BR:tca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     660781
Peptidases [BR:tca01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   660781
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG7
AA seq 928 aa AA seqDB search
MYSCSHLATATNIPIANILNSIERPVCADCGCTKPNLWICLFSNCLQICCGEKFNDHSTI
HNSKNPTHCIHMNLVTKRIWCYECKGEVFMEQPSAVSSTVPSYDSDPEMEGCTYKSRDSG
HGSYSTLRTNTPERMNVFAFEKTVGLNVGMSGDASDASDAEDSTEYSIDRPVGLVGLQNI
GNTCYMNAALQALSNAIPLTRFFLECATTVQILSEGKKPGLSRTYQTLIRDMWKKNGGYV
TPSGILYGIRSVYPMFRGYYQHDTQEFLRNFMDQLHEELKQVAPPEVATMTDSDTFSLAM
DEPALSSSYDSSEGEYETCDSGVSERSSLSDDTERPASSTKRRLSRSSSPGRRIRTRLQS
NTMVIDSQPSTSSSSASINKKQQKYRSIISDIFDGKLLSSVQCLTCDRVSSCVETFQDLS
LPIPSRDHLVVLHGRTTGPTATCSEAVIPMNEGWISWILAWLKSWFYGPVVTLHDCLAAF
FSTDELKGDNMYSCEKCNKLRNGIKFSKVLQLPEVLCIHLKRFRHELMFSSKISSAVSFP
LKGLDMRPYLHTDCISKVTTYELFSVICHYGTAGGGHYICYALNGGQWYEFDDQYVTRVP
PEKVQSCEAYVLFYRKVTNTADEIRSKAIKLAKTHSTEPHEVAYISKQWISRFNTCAEPG
AIDNSDFLCQHGSFHPDREIVFERLAVALPLPVYEYLHKKFGGCPPVTSINICPACLAFN
NRLLFEMETFVQLNREMQNKDVPLTHLISTSWYTQWHKFVQKRAADAPGPIDNSKINMNQ
IDVNECAEITEGIWNFFFNIYGGGPELRLRPKSLHRTESESSLPSDGGEQTKFVIPALKK
EKVDTIDKSVYCSGEPMEVEEIEGENECNGFAEEGDSPSDTLPNGICAISHSKLANVDND
VSDDEVCNVEVKNSKRHRRRRKALSNIN
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgtacagctgtagccatttagcgacagcgacgaacattcccatcgcaaacatcctcaat
tcgatcgagaggcccgtctgtgccgactgtggctgcacgaaaccgaacttatggatctgc
ctgttttccaactgtttgcagatctgttgtggggagaaattcaacgatcacagcactatc
cataattccaaaaaccccacacattgcattcacatgaacctcgtaacgaaacgaatatgg
tgttacgagtgcaaaggcgaagtcttcatggagcaaccatctgccgtttcctccaccgtt
ccctcatacgacagcgatccagaaatggaaggttgcacctacaaatcgcgcgattccggt
catggcagctacagcacccttcgtacgaacactccagaacgaatgaacgtcttcgctttc
gaaaaaacagtcggtcttaacgtcggaatgagcggagatgcgtcggacgcaagcgatgcc
gaagactcgacagagtacagcattgatagaccggtcggtctggtcggtctacaaaatatc
ggaaacacgtgttatatgaatgcagcgttgcaagctttaagcaatgccattcctttgaca
cgattcttcctcgaatgtgccaccacagtccagatcttatccgaagggaagaaaccgggt
ctgagcaggacttaccagactctaatccgggatatgtggaagaagaacgggggttatgtc
accccgtctgggattttatacgggatcaggagtgtctatccaatgtttcggggttattac
caacatgacactcaggagtttcttcgcaattttatggatcagttgcatgaagagttgaaa
caggtggcaccacctgaggtggctacgatgaccgattcggacacttttagtctagcgatg
gacgaacctgcgctcagttcgagctatgattcgagcgaaggggaatatgaaacgtgtgat
tctggggttagtgaaaggtctagtctgagcgatgataccgaaagaccggcaagtagcacg
aagaggaggctgagtcggtcgtccagtccggggaggaggatacggacgaggctacaaagc
aacactatggtgatagactcgcagccgagcacgagttcaagcagcgccagtataaacaag
aaacagcagaaataccgctcgatcatttcggatattttcgatggcaagcttttatcgtcc
gttcaatgtttgacttgtgatcgcgtttcaagttgtgtcgaaacattccaagacctttcc
cttcccataccgtcacgggaccatttggttgtgcttcatggtcgtacgacaggtccaaca
gcgacatgttcagaggccgtaattccaatgaacgaaggttggatttcatggattttggcg
tggctgaagtcttggttttacggccctgttgtgacactgcacgattgtttagcggccttt
ttcagcaccgatgaattgaaaggggacaacatgtacagttgtgagaagtgcaacaagtta
cggaacggtattaagtttagtaaagtgctccaattacccgaagtactttgtattcacttg
aagcgatttcgacacgagttgatgttcagtagtaaaatttcttcggcggtcagttttccc
ttaaagggtttagacatgcgaccgtatcttcataccgattgtatttcgaaagttacaact
tatgaattgttttcggttatttgtcattatggtacagccggtggtgggcattatatttgt
tatgcgttaaacggtgggcaatggtacgaattcgatgatcagtatgtaactcgggtgcca
cccgaaaaagtccagtcgtgtgaggcctatgttttgttttaccgaaaagtgaccaatacg
gccgacgaaattaggagtaaggcgatcaagttggcgaaaacgcattccacggaaccgcac
gaggtggcctacatttctaaacagtggataagcagattcaatacttgtgcggaaccgggc
gccatcgacaactcggattttctgtgccaacacggctccttccacccggaccgcgaaatc
gtgttcgaacgtctagctgtagctttacctttgcccgtctacgaatacctccacaaaaaa
ttcgggggttgtccccctgtcacaagtatcaacatttgtccggcgtgtctagccttcaat
aaccgacttttattcgaaatggaaactttcgttcaactaaaccgcgaaatgcaaaacaag
gatgttcctttaacacatctcatttccacttcttggtacacgcagtggcacaagttcgtc
cagaagcgagccgcggatgcgccgggtcctatcgacaactcgaaaatcaacatgaatcaa
attgacgtgaacgaatgtgcggaaataaccgaagggatttggaatttcttctttaatatt
tatgggggagggcctgagttgaggctccgtccgaagagtttgcatcggacggagagcgag
tcaagtctgccgagcgatggaggagaacaaacgaagtttgtgataccagctttgaagaaa
gagaaagttgatacgattgataagagtgtttattgttcgggggaacccatggaggtcgag
gagattgaaggggagaatgagtgtaatggatttgcggaagaaggggattcacctagtgat
actttacctaacggtatttgtgctataagtcattctaaattagctaacgttgacaacgac
gttagtgacgacgaagtgtgtaatgtagaagttaaaaatagcaaaaggcacaggagacga
agaaaagctttgtcgaacattaattaa

DBGET integrated database retrieval system