KEGG   Tribolium castaneum (red flour beetle): 660907Help
Entry
660907            CDS       T01046                                 

Definition
ubiquitin-specific protease
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
tca  Tribolium castaneum (red flour beetle)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG3
AA seq 633 aa AA seqDB search
MDPFEAHNITFLDLSGVDEQERQEVLDSLYAENANVQLPWRVSEHKVVQKTDVKNRFVAT
AAAHHHQDKAAVVASHPQVYLTNQVDYNAYMPPPDPSLYHHHPYSQYVVYSTYLPPVVTT
TIPITYTQTAPNANYITDDEYNHQAYVPPPVAAPEEKKEEPDANCNITTNGETTPGRANK
SWASLFSNSKNSGVINGNGVNEKSSSNEAVNKQNVDNNNDEDPIRNPRKAKFIDPNCYRM
GEFLLNYTIDGRTISLQPRGLINKSNYCYINSILQALLACPPVYNLLVGLSEQNTTAQKE
KATPIIDGMCRFVKEFQHLPAGLRVNRRNDKNQKKEQGLMIDYDLPFEPSWIYKMLNGVR
SDLFLVEGRQEDAEEFLGCLLNGLNDEMLELMKLVKSDLTINKFESKTSDQDTDKEWQVM
GPKNKGSITRQMEFVKTPISNIFGGFLKSRIHRTGDHSTYNIQPFFTLQLNIEKVKTVRE
ALEALVTKNQLEGVTNEKTNEEVEAWQQVTLEELPVILILHLKCFDFKLDGCTKIVKALE
FPIDLKIDSKLLSSKPMSPKEKQYKLFAVVYHDGKEATKGHYITDAFHVGYSSWIRYDDA
SVKSVQEDYVLKPQGTRVPYLLFYRRSDTIRSK
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atggatccattcgaggcacacaacattacatttctggatctcagcggggttgatgagcaa
gaacgacaggaggttttggattctctgtatgcagagaatgccaatgtgcagctgccttgg
agggtttcggaacataaagtcgtccaaaagaccgatgtaaaaaatcggtttgtcgccacc
gccgccgcccaccaccaccaggacaaagcggccgttgtggcttcccacccccaggtgtat
ctcaccaatcaagtcgactataatgcctacatgccgccccctgacccatcactatatcat
catcatccatactcgcaatacgtggtctactccacctatctgcccccagtcgtcaccacc
accatccccataacatacacgcaaaccgcccccaatgctaactacatcaccgacgatgag
tacaaccaccaggcgtatgtgccgccaccggtcgccgctcccgaagaaaaaaaagaggag
cccgacgctaattgtaatattacaacaaatggagaaacaactccaggaagagcgaataaa
tcgtgggctagtttgttcagtaattcgaaaaactcgggcgttattaacgggaatggagtc
aatgagaagtcttcatcgaacgaggctgtgaataaacaaaacgttgataataacaatgat
gaagatccgatcaggaatcccagaaaggccaagtttatcgatccgaactgctacagaatg
ggcgaatttctgttgaattataccatcgatggcagaaccataagtttacagccacgtggt
ttgatcaataagagcaactattgctacatcaattcgattttacaagcacttttagcctgt
cctcctgtttacaatttattagtaggcttatcggaacaaaacactacggctcagaaggag
aaagccacgcccatcattgacggaatgtgccgtttcgtcaaggaattccaacatttgcca
gccggtctgcgtgtgaatcggcgaaacgacaaaaaccagaaaaaggaacaaggtttaatg
atcgattacgacctgccatttgaaccttcttggatttacaaaatgttgaacggtgttaga
agcgatttgttcttggtggagggccgtcaggaagacgctgaagagtttctgggttgttta
ttaaacggactgaacgacgaaatgcttgaactaatgaaattggtgaaaagcgatcttacg
atcaataaattcgagtcgaaaacaagcgatcaagacacagacaaagagtggcaggttatg
ggaccaaaaaacaagggtagcataacgcgacaaatggaattcgtcaagacaccaattagt
aatattttcggtggcttcctcaagtcgaggattcacaggactggggatcattccacttac
aacatacaaccgttttttaccctgcaattaaatatcgagaaagtcaaaactgtgcgtgag
gcactcgaggctcttgttacgaaaaatcagctggagggcgtcaccaatgagaagaccaac
gaggaggtggaggcatggcaacaagtcactttggaagaacttccagttattttaattctg
catttaaagtgctttgattttaagctagatggatgtacaaaaattgtcaaagctttggag
tttcctatcgatttgaagattgattcaaaactgttatcttccaagccaatgtcgccaaaa
gagaaacagtataagttatttgccgtcgtgtatcatgatgggaaagaggcaacaaagggt
cattacattacggatgcctttcatgtcggctacagcagttggatacgatatgatgacgca
tcggtcaagtcagttcaagaagactacgttttgaagccacaaggaactagagttccctat
ttgttattttaccgtcgtagtgataccattagaagcaaataa

DBGET integrated database retrieval system