KEGG   Tribolium castaneum (red flour beetle): 661117Help
Entry
661117            CDS       T01046                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2B10-like
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    661117
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
LG9
AA seq 511 aa AA seqDB search
MFIRNLFLFCILLCASESYKILAIFPTPSHSHHTLASKLVKELAKRKHEVTFVSPFPQKE
TVENLKEISVEEIIPIFNQQKKHLFKLNELTLFENVIFVNNIGLLVTEELLRNEKIQKLL
ESNEHFDLIILPQFINEGLLAIGHHFKAPVVLLSSMPLFSWSSFLLGHPTSSSYVPNIQT
HYTGHMNFWQRLCNSIYDAYSILYHQWVVLPKHRQLVKKYVPGQPDLYDFLNNASLVLVN
SHVSSYDATIQVPNVVEIGGFHLEEAKKLPEDLQKYLDGSKEGVVIFSMGTLMKSSSMPK
EKLQALLQAFSKLKQQVLWKWDSEEMEGKPGNVKLVKWLPQSDVLAHPNVKVFITHGGLL
STMESIYHGVPTLGIPVFTDQKANIEFAVEAGSGIAVPYPELSEEKLSQALDQIINNASY
KTNALKRSKIMKDRPIHPLDYAIYWIEYVARHEGAPHLRYPGMGLAWYQRYLIDVAFFVG
LALVSVFIITKQLLKLFMGTQNKQKKKTKKN
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgttcatacggaatttgtttctattttgcattcttttgtgtgcttccgagagttacaaa
atcttagcaatcttccctacaccgtcccatagtcaccacaccttagcctccaaactcgta
aaggaattggcgaaaaggaaacatgaagtgacttttgttagtccattccctcaaaaggaa
accgtggaaaatttgaaggaaattagtgtagaggaaataataccaatatttaaccaacaa
aagaagcatttatttaaactcaacgagctgacacttttcgagaatgtgatctttgtgaac
aacattgggcttcttgtaacggaagagttactccgaaatgagaagatacaaaaattgtta
gagtcaaacgaacatttcgatctaataattctgccccagtttataaatgagggcttgttg
gccatcggccaccacttcaaagcaccggtggtacttctgtcatccatgccccttttctca
tggagcagttttctcctcggacacccaacttcctcatcttatgttccaaacatccagaca
cattacacagggcatatgaacttttggcaacgactttgcaacagcatttacgacgcttat
tccatcctttaccaccaatgggtcgtactaccaaaacacagacagctggtaaagaaatat
gtaccaggacagcccgacttgtacgattttctcaataacgccagtttagtgctagttaac
tcgcacgtgagttcgtatgatgccacaattcaagtaccaaatgtcgtggaaattggtggt
tttcacctcgaagaggcgaaaaaactaccggaggatctccaaaaatatttggatggttcc
aaggagggagttgtgatattttcaatggggacactaatgaaaagttcgagcatgccaaag
gaaaaattgcaagcactgctccaggcattttccaaactgaagcaacaagttttgtggaaa
tgggacagtgaagaaatggaaggaaagccgggaaatgtcaaattggtcaagtggttgcca
cagtccgatgttttagcccatccaaacgtaaaagtgtttatcacccatggtggcctttta
agtaccatggaaagcatataccacggggtaccaacattaggaattccggtttttaccgac
cagaaagcaaatattgaatttgcagtggaggcagggtctggcattgccgttccctatcca
gaattatcggaagaaaaattatctcaagctctggaccaaattataaataatgcaagctac
aagacaaacgccttgaagcggtcgaaaataatgaaggaccgacccatacacccattggat
tatgccatttactggatagagtatgtcgcccgacatgaaggggcaccacatcttaggtac
cctggaatgggcttggcttggtaccaacgatatttaatcgatgtcgcatttttcgtgggg
ttagcattagtatcagtttttattattaccaaacaattgttaaaattgttcatggggacg
caaaataaacaaaaaaagaagacgaaaaagaattga

DBGET integrated database retrieval system