KEGG   Tribolium castaneum (red flour beetle): 661391Help
Entry
661391            CDS       T01046                                 

Definition
UDP-glucuronosyltransferase-like
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    661391
   00053 Ascorbate and aldarate metabolism
    661391
   00500 Starch and sucrose metabolism
    661391
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    661391
   00860 Porphyrin and chlorophyll metabolism
    661391
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    661391
   00982 Drug metabolism - cytochrome P450
    661391
   00983 Drug metabolism - other enzymes
    661391
Enzymes [BR:tca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     661391
Glycosyltransferases [BR:tca01003]
 Others
  Hydrophobic molecule
   661391
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG9
AA seq 521 aa AA seqDB search
MMKLSTSLLFLFLGLICGTKSARILGIYPLPGRSHYRLGSALFRELAERGHDVTVISPFG
EKDPPKNGTYRDIVLDGIFEGDEKHKGKQWNMFKREGLNPFVGAYVVATMASKFMGVILN
HTKVQELLHSDEKFDVVITDNFLSDAFKAFAMHFDAPLIVINPVGPNFWINPLVGNPSPP
SYIPDILLNYYHPMTFCERMVNTLIYGFNFLLYNWMVFPRHNEYVKQFIPRGGDLNDILY
NTSLVLLNSHPSLNQPVPLVPNMIEIGGFHMKPAKKLPDDLQDFLDKSEEGVVYFSMGSN
LQSVLWPIEKREVFLKTFSKLKMKVLWKWEDDELPGKPPNVKISKWVPQMDVLAHPNLKL
FITHGGFVSSVETAYHGKPMLAIPIYGDQRNNANFAYKNGFGRYITYGNLTEENLLATIN
EMLDNPKYSENAKIRSQIFHDRQVHPMDTAVYWVEYVIRHRGAPHLQVAALDLPWYKYLL
VDVIFVVVMALSSLIFVTWFVLKKVCKKICAKKNTQKVKTN
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagctgtctacaagtttacttttcctatttttgggtttaatatgtggaaccaaa
agtgcacgtattttgggcatttaccctttgcctggccgtagccactaccgcctgggctcc
gctttattcagagaattagcagaaaggggacacgacgttactgtaatatccccatttggt
gaaaaagatcctccgaaaaatgggacctaccgagacatagtcctcgatggcatattcgaa
ggggatgagaaacacaaggggaaacaatggaacatgttcaaaagggaaggcttgaatcct
ttcgttggtgcatacgtggtggcaaccatggcgtctaaatttatgggagtgattctcaac
cacaccaaagtgcaagaactgctccattctgatgagaaattcgacgttgttattacagat
aatttcctgagcgatgcgtttaaagcatttgccatgcattttgacgccccactcattgta
attaatcccgtggggcccaacttctggataaaccccctcgttggcaacccttccccaccc
tcatacatccccgatattttactcaactattaccacccgatgacgttttgcgaaagaatg
gtaaacaccctaatctacggcttcaattttctgctctataactggatggtttttccccga
cacaacgagtacgtcaaacagtttatcccacgagggggcgacttaaacgacattctttac
aacacgtctttggtgcttttgaactcgcacccgagcctcaaccagccggtgcctctagtg
cccaacatgatcgaaattggcggatttcacatgaaaccggccaaaaaactaccggacgac
ttacaagacttcttggataagtccgaagaaggggtggtttacttcagtatgggctcaaac
cttcagagcgttttgtggccaattgagaagcgtgaggttttcctgaaaaccttctccaag
ctgaaaatgaaagttctgtggaagtgggaagacgacgaacttcccgggaagccaccaaat
gttaaaatatccaaatgggtgccccaaatggacgtccttgcccatcccaacttgaaacta
ttcatcacccatggtgggttcgtcagctcggtggagacagcctaccatggcaagcccatg
ctggccattcctatttatggcgatcagagaaacaacgccaattttgcgtacaagaacggg
tttgggcgctatattacttacggaaatcttacagaagaaaatttattagcaactataaac
gaaatgttggataatcccaaatatagtgaaaacgccaaaatcaggtcacaaattttccac
gatcgtcaggtgcacccaatggatacggccgtttattgggtcgaatatgtgataagacac
agaggggcaccacatttgcaagttgcagctcttgacttgccctggtacaaatatttgcta
gtagatgttatttttgtcgttgtaatggcactaagctctctaattttcgtaacctggttt
gtacttaagaaggtttgcaagaagatttgtgcaaaaaagaatacacaaaaagtcaaaacc
aattag

DBGET integrated database retrieval system