KEGG   Tribolium castaneum (red flour beetle): 661391Help
Entry
661391            CDS       T01046                                 

Definition
similar to CG18578-PA
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:tca00040]
Metabolism; Carbohydrate metabolism; Ascorbate and aldarate metabolism [PATH:tca00053]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tca00500]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:tca00830]
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tca00860]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:tca00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:tca00982]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:tca00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG9
AA seq 520 aa AA seqDB search
MKLSTSLLFLFLGLICGTKSARILGIYPLPGRSHYRLGSALFRELAERGHDVTVISPFGE
KDPPKNGTYRDIVLDGIFEGDEKHKGKQWNMFKREGLNPFVGAYVVATMASKFMGVILNH
TKVQELLHSDEKFDVVITDNFLSDAFKAFAMHFDAPLIVINPVGPNFWINPLVGNPSPPS
YIPDILLNYYHPMTFCERMVNTLIYGFNFLLYNWMVFPRHNEYVKQFIPRGGDLNDILYN
TSLVLLNSHPSLNQPVPLVPNMIEIGGFHMKPAKKLPDDLQDFLDKSEEGVVYFSMGSNL
QSVLWPIEKREVFLKTFSKLKMKVLWKWEDDELPGKPPNVKISKWVPQMDVLAHPNLKLF
ITHGGFVSSVETAYHGKPMLAIPIYGDQRNNANFAYKNGFGRYITYGNLTEENLLATINE
MLDNPKYSENAKIRSQIFHDRQVHPMDTAVYWVEYVIRHRGAPHLQVAALDLPWYKYLLV
DVIFVVVMALSSLIFVTWFVLKKVCKKICAKKNTQKVKTN
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtctacaagtttacttttcctatttttgggtttaatatgtggaaccaaaagt
gcacgtattttgggcatttaccctttgcctggccgtagccactaccgcctgggctccgct
ttattcagagaattagcagaaaggggacacgacgttactgtaatatccccatttggtgaa
aaagatcctccgaaaaatgggacctaccgagacatagtcctcgatggcatattcgaaggg
gatgagaaacacaaggggaaacaatggaacatgttcaaaagggaaggcttgaatcctttc
gttggtgcatacgtggtggcaaccatggcgtctaaatttatgggagtgattctcaaccac
accaaagtgcaagaactgctccattctgatgagaaattcgacgttgttattacagataat
ttcctgagcgatgcgtttaaagcatttgccatgcattttgacgccccactcattgtaatt
aatcccgtggggcccaacttctggataaaccccctcgttggcaacccttccccaccctca
tacatccccgatattttactcaactattaccacccgatgacgttttgcgaaagaatggta
aacaccctaatctacggcttcaattttctgctctataactggatggtttttccccgacac
aacgagtacgtcaaacagtttatcccacgagggggcgacttaaacgacattctttacaac
acgtctttggtgcttttgaactcgcacccgagcctcaaccagccggtgcctctagtgccc
aacatgatcgaaattggcggatttcacatgaaaccggccaaaaaactaccggacgactta
caagacttcttggataagtccgaagaaggggtggtttacttcagtatgggctcaaacctt
cagagcgttttgtggccaattgagaagcgtgaggttttcctgaaaaccttctccaagctg
aaaatgaaagttctgtggaagtgggaagacgacgaacttcccgggaagccaccaaatgtt
aaaatatccaaatgggtgccccaaatggacgtccttgcccatcccaacttgaaactattc
atcacccatggtgggttcgtcagctcggtggagacagcctaccatggcaagcccatgctg
gccattcctatttatggcgatcagagaaacaacgccaattttgcgtacaagaacgggttt
gggcgctatattacttacggaaatcttacagaagaaaatttattagcaactataaacgaa
atgttggataatcccaaatatagtgaaaacgccaaaatcaggtcacaaattttccacgat
cgtcaggtgcacccaatggatacggccgtttattgggtcgaatatgtgataagacacaga
ggggcaccacatttgcaagttgcagctcttgacttgccctggtacaaatatttgctagta
gatgttatttttgtcgttgtaatggcactaagctctctaattttcgtaacctggtttgta
cttaagaaggtttgcaagaagatttgtgcaaaaaagaatacacaaaaagtcaaaaccaat
tag

DBGET integrated database retrieval system