KEGG   Tribolium castaneum (red flour beetle): 661419Help
Entry
661419            CDS       T01046                                 

Definition
(RefSeq) dual specificity tyrosine-phosphorylation-regulated kinase 2
  KO
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Enzymes [BR:tca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     661419
Protein kinases [BR:tca01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   661419
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
LG5
AA seq 642 aa AA seqDB search
MEETTMRDLRVLIVGNAGHSIAQAMALVCDLISIGSGAASWCVVSACHGLGNPSGPRPLM
CAYHTYPSTRGSRTMGWTHADHSVFHTISPAAHHHKEVLPTKYGSKPPTTASGKHLNKSS
SKNGHSTSKTTLISELPLLESSKSSSRLNLNQSKTNLTPSSPMVDSFPAINNNSRTVEIQ
GTTNNNRENNGFPMTPTEALKLYGNRLTEYEKNEIEKYSKIWYLGLNACKIHGEVGGSQN
CGYDDESGSYIKVLHDHICYRYEILEVIGKGSFGQVIRALDHMTNKHVAIKIIRNKKRFQ
HPALVEVRILDHLRKKDKDGNHNVIHMSEHFTFRNHLCISFELLSLNLFELLKKNSYRGF
SLNLIRRFASSILKCLRLLQKENIIHCDLKPENVLLKERGSTSIRVIDFGSSCYTNQRVY
TYIQSRFYRSPEVILGLPYGTPIDMWSFGCILAELYTGYPLFPGENEVEQLACLMEVLGQ
PPDELIVNATRKRLFFDSRGNPRCITNSKGKKRKPGSKNLSTALHCDDPLFMDFISRCLE
WNAKKRMTPDEALRHEWILSGTSGYQKSGNDLRHSHSEVNVGHESYSSSSTSGSSHSRIY
HKNIAPKGDKVKAKILDTRLHDSISKLDSNLNDSGTFLPPIL
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atggaggagacgaccatgcgcgatctccgcgtattgatcgtcgggaacgcgggccacagc
atcgctcaggcaatggcattagtttgcgacctcatctcaatagggtccggtgccgcctcc
tggtgcgtagtgagtgcgtgtcatgggctcggaaaccccagcggcccgcggcccttgatg
tgtgcctaccacacgtaccccagcacccgggggtcccgaactatgggctggactcacgct
gaccactcggtattccatacaattagtccagcagctcaccaccataaagaagtattaccg
acaaagtatgggtccaagccaccgacgactgcatccggcaagcacttgaataaatcttct
tccaaaaatggtcattcaacatcgaaaactacgcttatttccgaattgccgttattggaa
agcagcaaatcgtcttcgcgactcaacctgaaccaaagcaagacaaatttgacaccgagc
tcaccgatggttgattcattcccggctatcaataataattcacgaactgtggaaattcaa
gggacgacaaacaacaacagggagaataatggctttcctatgacaccaacagaagctctt
aaactgtatgggaaccgtttgacagagtacgagaagaatgaaatagagaagtattccaag
atttggtatttgggcttaaatgcttgtaaaattcatggcgaagttgggggttcgcaaaac
tgtggttacgacgacgaaagtgggagctacatcaaggttctgcacgatcacatctgctac
cgatacgaaatcctggaagttattggaaagggtagctttgggcaagtcatcagggcgctc
gatcacatgaccaataagcatgtagcgatcaaaatcataaggaacaagaagcggttccaa
catccggcactggtagaagtccgaatactggatcatttgcgaaaaaaagacaaagatgga
aatcacaacgtcatccacatgtctgaacatttcacctttagaaatcacctctgcataagt
ttcgagttactaagccttaatcttttcgaactgctgaagaaaaacagctaccgtggattt
agtctaaatttaatcagaaggtttgccagttccattctcaaatgtctgaggcttctccag
aaggaaaacatcatacactgcgatcttaaaccggaaaatgttctgctgaaggaaagggga
agtacttcgataagagtaatagatttcggaagttcgtgttacacaaaccaacgggtttac
acttacatccagtctcgtttttatcgatcaccggaagtcatattggggttgccctatggg
acgcctattgatatgtggagttttggctgtatcttggccgagttgtacacgggttatcca
ttatttcctggcgaaaatgaagtcgagcaacttgcgtgcttgatggaagttttgggacag
ccacctgacgagctcattgtcaacgctactagaaagagattatttttcgattcccggggg
aaccccagatgcatcacaaactccaagggcaagaaacgcaagccaggatcgaagaacttg
tcgacagcactgcactgtgatgatcccttgtttatggacttcatatccaggtgtcttgag
tggaacgccaagaagagaatgacaccagatgaagcgttgcgccacgaatggattctctcg
ggcacttcgggctaccaaaagtctggaaatgacttacgacacagccattctgaagtaaac
gtaggccacgagagttattcgtctagcagtacttccggcagcagccattcccgcatttat
cataaaaatatcgctcccaagggtgataaagtcaaggccaaaattttagatactagatta
catgatagtatttctaaactagattcaaacttgaacgattcgggaacttttcttcccccg
attctttag

DBGET integrated database retrieval system