KEGG   Tribolium castaneum (red flour beetle): 661462Help
Entry
661462            CDS       T01046                                 

Definition
annulin-like
Orthology
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Enzymes [BR:tca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     661462
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG5
AA seq 755 aa AA seqDB search
MGKLRCPRWCNCIPCFRAKFTPNHDTALQPLPKPKEADETDGVPFIDSKEESDILIIRKI
DPCTIINGISHHTSKFELMNRQFEPQLVVRRGQSFRLDITLSRPYKEEKDGISFIFTVDD
EDKPNYGQGTLVAVPLLRRPDRHLNWNVVLENAIENTITVQITTAPDAVVAKWHMEVDTK
IINDSAYSYSWDTGIYLLFNPWCKQDQVFMKSEDWRDETVLNDVGIIWRGTANRMRPVIW
KYDQFEKDILECSLYLIRIVGKVKCGYRADPVRTARALAAAVNSADDLGAVMGNWSEDHS
GGTPPTKWIGSKEILQKYYKKKRPVKYGQCWVFSGVLATICRAIGIPARTVTNYSSAHDT
QSSLTVDYFTDEKGSVMEELNSDSIWNFHVWNEVWMQRPDLGRDYAGWQAIDATPQELSE
DMYRVGPTSVFAVKQGEVLRPYDGAFLYAEVNADKVFWRYAGPTQPLKLLRKDVHGVGKQ
ISTKAPGRFEREDITSLYKYPEKSPEERNTMLKALRQSENLFSRYYLNEDFNDIHFNFEL
RDDIKIGQPFDVALVMKNRNKITDYKVKIILRVEVVTYRGKVGENVKKEDFDMTVKSDST
CEVKMNVTYNEYAKRVVDQCSFIISCLATVEDTKFEYYAQDDFRVRKPDIKIVLQDKPVE
NKEVTADIFVENPLPVPYKKGEFTIEGPGIEKSLKVRVKNNVPPRETAKAQFKFTPPRTG
RHTIAAKFVSKEIDDVDGYLVIMVEPNKEENGSRL
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atggggaaactgcggtgtccgcgttggtgcaattgcatcccttgcttccgcgcaaaattt
acccctaatcatgacacagccttgcaacccttacccaagccaaaagaagcagacgaaacg
gacggcgtgccatttatcgactcgaaggaggaatctgacattttaataattcgaaaaatt
gacccgtgcactatcatcaatggaatttctcatcacacatcaaaatttgaactcatgaac
cgccagttcgagccgcaacttgtggtgcggagaggtcaaagtttccggcttgatatcacc
ctcagccggccgtacaaggaggagaaggacgggatttccttcattttcacagttgacgac
gaggataaaccaaactacggccagggcactttggtggccgttcccctcctgaggcggccc
gatcgccacttgaactggaacgtggttctggaaaatgcaatcgaaaacacgatcacggtc
cagattaccacggctccagacgccgtggtggcgaagtggcacatggaggtcgacaccaaa
atcatcaacgacagtgcttacagctacagctgggacacggggatttacctcttgttcaac
ccctggtgcaagcaagaccaggtgtttatgaagtcggaggactggagggatgagacggtt
cttaacgacgttggaatcatttggagagggacagcgaaccggatgcggcccgtgatctgg
aaatacgaccagttcgagaaagatatcctcgaatgttcgctctacttgattcgaattgtt
ggcaaagtcaagtgtgggtacagagccgaccctgtcaggacggccagagccttggcagct
gctgttaactcagccgatgacttgggggctgtcatgggcaactggtcggaggaccacagt
ggcggaacgccgccaaccaagtggatcgggagcaaggaaattttgcaaaaatactacaag
aagaaacgaccggtcaagtacggccagtgctgggtcttctccggcgttttggcaacaatt
tgtcgtgcaattgggattccggctcgcactgtgactaactattcctcagctcacgacact
cagagctccctgactgttgattacttcaccgatgagaaaggttcagtgatggaagagttg
aactcggactcgatttggaacttccacgtctggaacgaagtttggatgcagaggcctgat
ttggggcgagattacgcgggttggcaggccatcgacgccactcctcaagaattgagcgag
gacatgtacagagtgggccccacttcggtcttcgccgtcaaacaaggcgaggttttacgg
ccctatgatggggcttttctgtacgccgaagtgaacgccgacaaggtgttttggagatac
gctgggcccacgcaaccgttgaaactcctccgtaaggatgtgcacggggttgggaagcaa
atcagcaccaaagctccagggaggttcgaacgcgaagacatcacaagtttgtacaaatac
ccggaaaaatctcccgaggaaagaaacacaatgctgaaagcattgcgtcaatcggaaaat
ttgttctcgcgttattacctaaacgaggacttcaacgacatccactttaatttcgaacta
agggacgatattaaaatcggtcagccgtttgacgttgccctagtcatgaaaaataggaac
aagatcaccgattacaaagtcaaaatcattctgcgagttgaggttgtaacataccgtgga
aaagtcggggaaaacgtgaaaaaagaagacttcgacatgacggttaagtcggactcgacg
tgcgaagttaaaatgaatgtgacctataacgagtacgccaagcgtgttgttgaccaatgt
tcttttataatttcctgtctggcgacggttgaagacaccaagtttgagtactacgcccag
gacgattttagagtccgcaagcctgatattaagattgttttgcaagacaaaccagtcgag
aataaggaagtcactgccgatattttcgtagaaaatcctttgcccgtgccgtacaaaaag
ggtgagtttacgatcgaagggccaggtatcgagaagagccttaaagtcagggttaaaaat
aatgttcctccaagagaaacggccaaagcacagtttaaattcacaccgccgaggactgga
cgccacaccattgccgccaaatttgtgtcgaaggaaattgatgatgttgatggctatctg
gtgattatggttgagcccaacaaggaggagaatggaagcaggctttaa

DBGET integrated database retrieval system