KEGG   Tribolium castaneum (red flour beetle): 661487Help
Entry
661487            CDS       T01046                                 

Definition
similar to ubiquitin specific protease 9, X-linked isoform 2
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.1.2.15]
Organism
tca  Tribolium castaneum (red flour beetle)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG5
AA seq 2440 aa AA seqDB search
MTIATRGQGVTGENLDVQGPAPGPSEATTDELPNENAEPDFPHDKLASLDEKISNIRWVV
PVLPDQELECLLKVSIDLARKNLDTRSEACQRFFREGLTTSFTKILTDDAVSSWKANIHA
CIHNNCLKLIELCVAKLSHDWFPLLDLLAMVLNPNNKFHTFNSSRQSETAGPGSTLSEEE
LFARPSNDLRNPRGWLVDLINRFGELGGFQLLLDRFQSGKNLSVSVVFALLRPFGLCYEF
LTPHTINKFILPILEMVPGILEKLTDDELKREAKNESKSDIVSAIIKSSKNLASRVPNQE
ELIRTLEGFRLTMILRQLQISSFNGKMNALNEINKVISSVSYYPNRHHGIEEEEYLTPER
MAKWINENRVLEIVLRDSLHQPQYVEKLEKILRFVIKERALSLKDLDAVWAAQAGKHEAI
VKNVHDLLAKLAWDFSADQLDHLFECFQNSWTSASKRQRERLLELIRRLAEDDKDGVMAH
KVLTLFWNLAHAEDVTTEIMDQALSAHVKILDYSCSQERDAQKTVWLDKCVEELKNGEIW
VLPALKQIREICLLYEQNTNGGHGQRTHHMYYRQEVIERLQSQHSLVILVTNSLTSYMDH
LRNLYKEQPELTSETYVPDGRYCHALQVQERLNFLRFLLKDGQLWLCKEQAKQIWQCLAE
NAVFQSDREACFKWFSKLMGEEPDLDPGINKDFFENNILTLDPLLLTESGIKCFERFFKA
VNTKAEKLKLKRRSLLTEDPDLIGLDYLWKVVTLCPDDIAERAIELLREVSTNLGPRLQQ
SQMEFHENFITECHDRLRAHYDTVTVLQKSENDKDFNKNQMQNRIRAEAVKMCRVMRVLH
EYISECDIAFLGERKILPLYRACRGKHLAVIVRFSSPSRQVEDLEMFTHSNDTLASLRRH
ILRRIKPGVHCKLELFINGEPLDPADDRKLLSQMPIRDKMLISAKVMQVNSNMASSQDSS
SDSSTSSPQHPYDGPNIEAENLLPGVLMSTQHVYAQFFCQLSHLGSVLEYPPLRDGGYGL
LQLMPCDTETTEKLRILFTTPGEQNITMDNMFFSATPAEVLYNLEVLYAMLMPAIEPLSE
KTYEFQYSFMTSGEAHLFLEMLTKNNFMSSADNVTRRSAYLVVLKICKLILTSVAHVLVR
LSEDHTPPETEPSSENITTPGMHLRSALRTIPGHSDQILRQVSMKLSQGLSHQALNWELP
DLNTTLALLRLVWAASSDNLNALNASPEVLHSLADPKKRNVPLELHTNEILLVKEALELL
SIALVLNPSSLQHLYHDKRWPYFITDLVLLNPSCAVRIAAAEQLIIICTCGAASRLALQL
ITPLLFSLLDTLVLENANTSHELFQLLSQLVNVAYLTGCPLQNADALLAKEVAWLRKARD
KNEVLIEGHLTLTKELLHFLTPEQKCELGSADTGSFIKELLEDFLFPASKLMLQLSKTGL
LGEDPAIPVCDTPQTQAAAFNLLISLCLNCVQNFKQLVSMLTEMFYSDPETAIVEWDYLP
TIGPRPFQGFVGLKNAGATCYMNSVLQQLYMVESIREGILAAEGAATDPNEDFTGEERLE
LDADCTDDRNCFDDNRKDYNVGILKQVQAIFGHLACSRLQYYVPRGLWRHFKLQGEPVNL
REQQDAVEFFMSLIESLDEALKTLGHEQIMSKILGGSYSDQKICKGCPHRYSKEEPFSVI
SVDIRNHSSLQDSMEQYVKGELLEGADAYYCEKCAKKVVTVKRLCVKKLPPILGIQLKRF
EYDFERVCAIKFNDYFEFPRDLDMEPYTVSGLAKIEGEIIDCDLDPNASDTCTKYRLSGI
VVHSGQASGGHYYSYIRHRDASGDVRWYKFDDGDVSECRMGEDDEMKVQCFGGDYMGEVF
DPMLKRTTYRRQKRWWNAYMLFYTRHDVEENDLTKAMNEMKICRKETHLKMPLAIENSIR
KQNIKFLHHRSQFSIEYFSFIKKLASSCAQPNPRPGQSNDLIEQQTLLSVQLLSNFLFHT
GWHTKKNLRGPAMDWCDVLCMHLRFSPAIRSWFAHNMLFSHMHRFCDYLLSCPSNEVRSA
FIKIIVLLAHFSINDGPCPCPPGMNNPDPNASLSDHVLWALLGLLQREVSEHGRHLPHYC
SVFHMYANQGVQEKAQLLKMNVPATFMLVALDEGPGPAIKYQYTELGKLNQLVSCLIRCC
DVSSKCQSSTGGPILPNPYADPMCPDYIMPISPQAADILYNRSSYIKKVIEDTNLTDEAI
KLLQFCSWENPHFSRTVLSELLWQIAFAYCQELRHHIEILLSVLVIEDSWQTHRIHNAIK
GVPEEREGLLETIVRAKNHYQKRAYQCIKCMVALFSKCQAARIMLNNQADLRRTWTASVA
WLQDELERKYPASTQYAYSTWSPPAQSNDSSNGYFLERSNSARKTLERALELMPDLEREE
EDVSEEQESQEEVVETAQSEEAKPELPDITQSCEHTPNTY
NT seq 7323 nt NT seq  +upstreamnt  +downstreamnt
atgactattgcaacgagaggtcagggagttacaggagaaaacttggatgtgcaaggtcca
gctcctgggccgtcagaggcaaccactgacgaattaccaaacgaaaatgccgaacccgat
ttcccccacgataaactagcgtctttagacgagaaaatatcaaatataagatgggtggtg
ccagtgttgcccgaccaagaactagaatgtttactcaaagtttcaatcgatttagcgcga
aaaaatttggatacgagatcagaggcgtgtcagcggttctttcgtgagggccttaccacc
tccttcaccaaaatcctcactgacgacgccgtctcgagctggaaggcgaatatccatgcc
tgcatccacaataactgcttgaaattgattgaattatgtgttgccaaactgtctcacgat
tggtttccgctgctggatttgttggcgatggtcttgaacccaaataataagtttcacacc
ttcaattcgtcaagacagagtgaaacggctggccctgggtcgactttgagtgaagaggaa
ttgtttgctagaccgtctaatgatcttagaaaccccagagggtggttggttgatctcata
aatcggtttggggaacttgggggattccagttgctgttagataggtttcaaagtggtaaa
aatttaagtgtctctgttgtatttgcacttctgcgaccgtttggactttgttacgaattt
ttaactccgcatacgatcaacaagtttattctacccatattggaaatggttcctggcata
ttagaaaaactgaccgacgatgaattaaagagagaagcaaaaaacgaaagtaaaagcgac
attgtctcagctataataaaatcatcaaaaaacctagcctcgcgcgttcccaatcaagaa
gaactaatccgaactcttgaaggtttccgtctcactatgattttaagacagttgcaaatt
tccagttttaatggaaaaatgaacgcattaaacgaaataaataaagtcatttctagcgtt
agttactatccaaatagacatcacggaattgaggaagaggaatatctaacaccagaaaga
atggccaaatggattaatgaaaatcgcgtcttggaaatcgttttgcgcgactcgctccac
caaccccagtacgtggaaaagctggagaaaattctacgtttcgtaataaaagaacgagcg
ttgagtctcaaagacttggacgctgtgtgggcagctcaagccgggaaacacgaagctatc
gtgaaaaacgtccacgatttactcgcgaagctcgcatgggacttcagcgccgaccagttg
gaccatttgttcgagtgttttcaaaacagttggacgtcggcatcgaagcgtcaaagagaa
agattgttggagctgattcggcgattggctgaagacgacaaagacggcgtgatggcacat
aaagtattgacgcttttttggaatttggcgcacgctgaagacgtaacgacggagatcatg
gatcaggcgttgtccgcacacgtgaaaatcctcgattatagttgttcgcaggagagagat
gcgcagaaaactgtgtggttggataagtgcgttgaggaattgaagaatggggaaatatgg
gtgttgcccgctttgaaacagatacgcgagatatgcttgttgtatgagcagaatacgaac
ggggggcatgggcagaggacgcatcatatgtattaccgacaggaggttatcgagagattg
caaagtcaacactcgctcgttattttagttacgaatagtcttacgagttacatggatcat
ctacgtaatctttataaggaacagccagaattgactagcgaaacttatgttcccgatgga
cgctactgccatgccttgcaagttcaagagagactgaattttctcagatttctcctaaaa
gacggacaactgtggctgtgcaaagagcaggctaagcagatctggcagtgtctggctgaa
aacgcagtgtttcaatcggaccgtgaagcctgtttcaagtggttttctaagctaatgggt
gaagaacccgacttagatcccggaataaacaaagactttttcgaaaacaatattcttacg
ctcgatccacttttgctcaccgaaagcggtatcaaatgtttcgaacgttttttcaaagca
gtcaacacaaaggctgaaaaacttaaactgaaacggcgctccctacttaccgaagatccc
gatctgatcggtttagactacttgtggaaagtggtaactttatgtcctgatgatattgcc
gaaagagcgattgaattattacgcgaggtcagtacgaatctagggccgagattgcagcag
tcgcagatggaattccacgagaattttataacggagtgtcacgacagactgcgtgctcat
tacgatacggtcacagtattgcaaaagtcggaaaacgacaaagattttaataagaatcaa
atgcagaataggatcagagccgaggctgtgaagatgtgtagagtgatgcgtgtcctgcat
gagtatataagtgaatgtgatattgcttttttgggggagaggaaaatcctgccgttgtat
cgcgcctgcagagggaaacatttggcggtgattgtgcgcttttcgagtcctagtcggcaa
gtggaagacttggaaatgttcacgcactcgaacgatacgttggcgtcgctgcgtcggcac
attttgcgccggattaagccgggggttcactgcaaattggagctttttattaacggggaa
cccctggatccggccgacgatcgcaagttgttgtcgcagatgccgatccgggataaaatg
cttatttcggcaaaggtgatgcaagtcaattccaatatggcatcgtcgcaagacagcagt
tccgatagttcaacttcgtccccgcaacatccctacgacggacctaacattgaagcggaa
aatttgttaccaggtgttctcatgtcgactcaacacgtctacgctcagtttttctgtcaa
ttgtctcatctcggcagcgttttggagtaccccccgctgcgagacggaggctacggactt
ctccaattaatgccctgtgatactgaaacaacggaaaaattgcgaattctttttaccact
cccggggaacaaaatatcacgatggataatatgtttttcagtgcgactccagctgaagtc
ttgtataacttggaagtgctgtatgcgatgctaatgccagcgatagaaccgttatcggaa
aaaacgtacgaatttcagtacagctttatgacgtcgggtgaagcccacctattcctagaa
atgttaacgaaaaacaactttatgtcaagtgccgacaatgttactcgtagatcagcatat
ttagtagttttaaaaatttgcaaacttattttaacttctgttgcgcatgtacttgtgaga
ttgagcgaggatcacacaccgccggaaacagaaccgagcagtgaaaacatcacaacgccc
ggaatgcatctacgatcggcgctacggacgattcctggacattctgatcagattttgcgg
caggtgtcgatgaagttatctcaggggctctcccatcaggcgctaaactgggaactgccc
gatttgaacacaacattggcactgttgcgtttggtgtgggcagcaagtagcgacaatttg
aacgctttgaacgcctcgcctgaggtgcttcactccctcgccgatccaaagaaacgcaac
gtaccgttagaattgcacaccaacgagattctcttggtgaaagaagcattagaactgctc
agcatcgctctagtcctgaaccctagtagtttgcagcatctttatcacgacaaaaggtgg
ccttactttatcacggatttagttctattaaatccgagctgcgccgttcgcatcgccgcc
gccgaacaactgatcatcatttgtacatgtggtgctgcgagcagattagctctccagtta
atcacgcctttgttgttctccttgttggacacgttagtgttggaaaatgcaaatacgtcg
cacgaactttttcaattgttgagtcagttagtgaacgttgcttatttgacgggttgtccg
ttacaaaacgctgacgctttattagccaaagaagtcgcttggttgcgcaaagcgagagat
aaaaacgaggttcttattgaaggacatttgacgttgacgaaggaactacttcattttctc
acgccggagcaaaaatgtgaattgggaagtgccgataccggaagttttatcaaggaattg
ctcgaagattttctctttccggccagcaagttgatgttgcagttgagcaaaacgggactg
ttgggcgaagatcccgcgataccggtctgcgatacgccgcagacacaagcagcagctttt
aatcttttgatttcgctgtgtttgaactgtgttcagaattttaagcagttggtcagcatg
ctgacggaaatgttctattcggatcctgagacagcgatagtggaatgggattatctgccc
accattggtcctcgtccatttcaaggtttcgtcggtttgaagaacgccggcgccacctgt
tacatgaattcggtgttgcaacagttgtacatggtggagagcatccgcgaaggcattttg
gcggccgaaggcgcggccaccgacccgaacgaggatttcaccggcgaagaacgtctggaa
ttagacgctgattgcaccgacgatcgcaactgtttcgacgataaccgaaaagattacaac
gtcggtattctgaagcaggtacaagcaatattcggtcacttggcctgttcacgccttcaa
tactatgtgcctaggggactttggagacattttaaacttcaaggtgagccagttaatctg
cgggaacaacaggacgctgtagaatttttcatgtcgcttatagaaagtttagacgaggcg
ttgaaaaccctcggacacgaacagatcatgtccaagattttgggcggttcgtattctgat
caaaaaatttgtaaaggctgtcctcatcggtattcgaaagaggagccgttcagtgttatt
agtgtagatataaggaatcatagcagtttgcaagattcaatggagcagtatgtcaaaggg
gaattgttggagggcgctgacgcttattattgcgagaagtgcgccaaaaaagtagtaaca
gtgaagcgactgtgtgtcaagaagctgccgcctattttaggaatacagttgaagcgattt
gaatatgattttgaacgagtttgtgccatcaagtttaacgactattttgagttccctaga
gatttggatatggagccgtatacagtttcaggattggcgaaaatcgaaggggagattata
gactgtgatttagatcccaatgcaagtgatacttgtactaaatatcgcctgtctgggata
gttgtacattcaggtcaagcctcaggtggtcactattattcgtatattagacaccgggac
gcttccggtgacgtcaggtggtataaattcgacgacggtgacgtgtcagagtgtcgaatg
ggcgaagacgacgaaatgaaagtccagtgttttgggggcgattacatgggggaggttttt
gacccgatgttgaaacgaacgacgtatagaagacagaaacggtggtggaacgcctatatg
ctcttctacaccagacacgacgtcgaagaaaacgacttaacgaaagcgatgaacgaaatg
aaaatttgcagaaaagaaactcatctgaaaatgccgctggcaatagagaacagcatccgc
aagcaaaacatcaaattcctccaccatcggagtcaattctcgatagaatatttttcgttt
attaaaaaactagcgagtagttgcgcgcagccaaaccctcgtcctggccaatcaaatgat
ttgattgagcaacaaactctactcagcgtccaactgctcagcaactttctgtttcataca
gggtggcatacgaagaagaacttgcgcgggcctgcaatggactggtgcgatgtgctgtgc
atgcacttgcgcttttccccggcaatccgctcgtggtttgcccataacatgttgttcagt
cacatgcacagattctgcgactacctgctcagctgtccgagtaacgaagttaggtccgct
tttattaaaatcatcgttttattggcgcacttttcgatcaatgacgggccgtgtccttgt
ccccctgggatgaataatcccgatccgaacgcgtcgttgagtgatcatgtgttgtgggcg
cttttggggctactacaaagggaagtgagcgaacacgggcgtcatttgccgcattattgt
tccgtttttcacatgtatgccaatcaaggcgtgcaggagaaggctcaacttttgaaaatg
aacgtgccagctacgtttatgttggtcgcgttggacgagggtccaggaccggcgattaaa
taccagtatacagaattaggaaagttaaatcaattagtttcatgtttgatacgttgctgt
gatgttagttccaaatgccagtcgagtacgggtggccccattttacctaatccgtatgcg
gatcctatgtgtcccgattatattatgccgatatctcctcaagccgccgatattctctat
aatcgttctagttatatcaaaaaagtaatcgaggacaccaatttaaccgacgaagccatc
aaactcctccagttctgttcgtgggagaaccctcacttttcgcgcaccgttctctctgaa
ctgctgtggcagatcgcattcgcctactgtcaggaacttcgccatcacatcgagatactc
ctgtccgtgttagtgatcgaggactcgtggcaaacccaccgcatccacaacgcaatcaaa
ggcgttcccgaggaacgcgaaggtcttctagagacaatagtacgtgccaagaatcattat
cagaaacgagcttatcagtgcataaaatgcatggtggcgctgttcagcaaatgccaagcc
gctcgcatcatgctgaacaatcaggcggacctgaggcggacttggaccgcctccgtggcc
tggctccaggacgagctggagcgaaagtacccagccagcacccagtacgcttacagcact
tggtcgccgccggctcagagcaacgacagctcgaacggctacttcctggagcggtcgaac
agcgcgaggaagacgctggaaagggcgctggagctgatgccggacctggagcgggaggag
gaggacgtgagcgaagagcaggaatctcaggaggaggtggtggagacggcgcaaagcgag
gaagccaagcccgagctgcctgatatcacacaaagttgcgaacacactcctaacacgtac
tag

DBGET integrated database retrieval system