KEGG   Tribolium castaneum (red flour beetle): 661605Help
Entry
661605            CDS       T01046                                 

Definition
eIF3-S9-like
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tca00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    661605
Translation factors [BR:tca03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    661605
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG8
AA seq 701 aa AA seqDB search
MAKKKVDDKNSLNGNNTKNESDLSSNDDEPNFSDPEGYVDNITDEELLADILKQKPKETD
GVESVIVVDGVPQVGPDRIEKLKSVINKIFVKFGSIVNEYYPVTENGHTKGYIFLEYSSP
VNAAEAVKLTNNFKLDKQHTFQVNLFTDFTKYEAIPEEWDPPKPQPYEGQGDVHHYLLEP
DAYDQFAVVLGQGQSVQIWQNTQPDPSLLEERHAWTHAYIKWSPLGTYLATFHKQGIALW
VGQKFSQYKRYAHANAQFIDFSPCEKYLVTYSPQGDPQHPQQKGIIIWDIRTGQEKRSFN
PEGPSSWPIFRWSHDDKYFGRVGNDVLSIYETPSFGLLEKKSIKISGIRDFSWSPTDNIV
AYWVAEDKDVPASVTLLEIPNRNEIRKKNLFNVADCKIHWQKSGDYLCVKVDRYSKVRKE
KNETKYSGMYCNFEIFHMREKQIPVDSVESKEPIQAFAWEPVGSKFAVIHGESPNINVSF
YEVRVGQAPILLKKFEKRACNHLFWSPGGQFIVLAGLGSNGGGSLEFVDTHEFLVMNTTD
HFQMSDVEWDPTGRYVTTSVSYWKTKVDTGYWIWSFQGKILKRVNLEKFAQLLWRPRPAT
LLSEEKQKEIKKNLKKYYPQFESKDRMRQSKASKELIEKRAALMKEFNEYRSKRIKEYNE
NKQRRLQLRNNIDTDELDADPQNVEEEIVEFFIKEETTILD
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaaagaaagtggacgacaaaaacagccttaacgggaataatacgaagaacgag
agcgatttatcgtccaacgatgatgaaccaaacttcagcgatcccgagggatacgtcgac
aacatcaccgatgaagagctcctggccgatattttgaagcagaagccgaaggagactgac
ggtgttgagagcgtgattgtggtcgacggtgtcccgcaagtgggccccgaccgtatcgag
aaattgaaatccgtcattaataagattttcgtcaagttcggatccatagtcaatgagtac
tatccagtgaccgaaaacggtcacaccaaaggctacattttcctggaatactcctctcca
gtcaacgcagctgaagccgtgaagctcaccaataatttcaagcttgataagcagcacact
ttccaagtcaatctcttcactgactttaccaaatatgaggcgattccggaggagtgggac
cccccgaagccgcagccctacgagggccagggggacgtccaccactatttgctcgagcct
gatgcttacgaccaatttgccgtggttttgggacagggacagtcggttcaaatttggcaa
aatacgcagcctgatccttccttacttgaggagagacatgcttggacacatgcttatatc
aagtggtctccgttaggtacgtatttagccactttccataagcaaggtatcgcgttatgg
gtgggtcagaagtttagccaatacaaaaggtatgcccatgccaatgcacaatttattgat
ttttcgccgtgcgagaagtatttggtgacgtactcgcctcagggagatccgcagcatccg
caacagaaagggatcattatttgggatataagaactggccaagaaaagcgttctttcaac
cctgaaggcccctcctcatggccgattttccgctggtctcacgacgacaaatacttcgga
cgcgtgggcaacgacgtcctctccatctacgaaaccccctcgttcggtctccttgagaaa
aaatcaatcaaaatcagcggcatccgcgacttcagctggtcgcccaccgacaacatcgtc
gcctattgggtggcagaagacaaagacgttccagccagcgtaaccctccttgaaatcccc
aaccgcaacgaaatccgcaagaagaacctcttcaacgtcgccgattgcaaaatccactgg
caaaaatctggcgattatctatgcgtcaaagtcgaccgttactcgaaagttcgcaaagag
aaaaatgagacgaagtacagcggaatgtactgcaacttcgagatcttccacatgagggaa
aaacagatcccggtggatagcgtcgagagtaaggaacccatccaggcgttcgcttgggaa
ccggtcggatcgaagtttgcggtcatacatggagaatcgccgaatattaatgtcagtttt
tacgaagtgagagtgggacaagccccaattctgcttaaaaagttcgagaaaagggcgtgt
aatcacctgttttggtcgcccggaggccagtttattgttttggcggggttgggatcgaat
ggtggtggatcattggagtttgttgatacgcacgagtttttggttatgaatacgacggat
catttccaaatgtcggatgtcgagtgggatccgacgggaagatacgtcacgacgtccgtt
tcgtactggaaaaccaaagttgatacaggttattggatttggtcgttccaaggaaaaatc
ctgaaacgtgttaatttggaaaaattcgcccagttgttgtggcgtccacgacctgcaact
ttattgtctgaagaaaagcagaaagaaatcaaaaagaacctcaaaaagtattatccacag
tttgagagcaaagacagaatgagacaatcgaaagcttcaaaggaacttatcgaaaaacgt
gccgctttaatgaaggagtttaacgaatacagaagtaaaaggattaaggaatataacgag
aataagcaaagacgacttcaacttagaaataatattgataccgatgaattagatgccgac
ccacaaaacgtagaagaagaaattgtagaattctttattaaagaggaaacaaccattttg
gactaa

DBGET integrated database retrieval system