KEGG   Tribolium castaneum (red flour beetle): 661663Help
Entry
661663            CDS       T01046                                 

Definition
olygosaccharyltransferase alpha subunit-like
Orthology
K12666  
oligosaccharyltransferase complex subunit alpha (ribophorin I)
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
N-Glycan biosynthesis
Metabolic pathways
Protein processing in endoplasmic reticulum
Module
Oligosaccharyltransferase
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:tca00510]
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:tca04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG1=X
AA seq 459 aa AA seqDB search
MYKFVVLFICMCSVISAEQINQLVINKNVERTIDLTSQLVKITATITLENTGKDTVRNYL
IVLEPDTVGNLSYISVKDSLKEDLKLTPSKVEKHEKDVYSVQLKQPLATGRTAGIILEAV
FTKGLVPYPNSITQKEKQLVRYFGNHYFYTPYATSKQTTSVTLSSRSVESYTKLKPVSQS
DSTLTYGPYSDIPAFSQDRMIVHYENNSPFLTVTRLERLIEISHWGNIAVEENIEILHTG
AKLKGPFSRYDYQRDTGSSHHSIKSYRTILPAAAYNIYYRDSNGNISTSQVRTRKDWIEL
ELRPRFPLFGGWRSSYTLGYSVPSYQYLYRKSSTEYVLNMRLLDHVFDDMHVEELETKVV
LPVGVTEVQIKTPYEVQRLPDGVTFKYLDQFGRSVIKLRKTNLVEQHIQDLEIVYHWRSG
LLLLEPVLLALALYVLFIIVIIYVRLDFSIHKPEHAKKE
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagtttgtcgttttatttatttgtatgtgttcggtaatcagtgcggagcaaata
aatcaactcgtaattaacaaaaatgtcgaaagaacgatcgatttaacatcacaactagtc
aagataactgcgaccataaccttagaaaataccggcaaagacacagttcgaaattaccta
atagtgctggaaccggacactgtgggcaatctatcgtacatttcggtgaaagactcgctt
aaagaagacttaaaattgaccccaagcaaggtagaaaagcacgaaaaggacgtctacagt
gtccagctgaagcagcctttggcgaccggtcgcacggccgggatcatccttgaggctgtt
ttcaccaagggtctggtaccgtaccccaacagcataacgcagaaggagaaacaactggtc
aggtacttcggaaatcactatttttacacaccctatgcgacaagtaaacagacaacgagc
gtgacattgagctccagaagcgtcgaaagctacacgaaattgaaaccagtgagtcagtcc
gactccaccttaacctatggcccttatagcgacatcccggcgttttcgcaagaccgcatg
atcgtgcattatgagaacaactcgccctttttgaccgtcacgcgcctggagcgccttatt
gaaatctcccactggggcaacatcgccgtcgaggagaacatcgagattctgcacacgggg
gccaaattgaaggggcctttctcgcgctatgactaccagagagacaccggcagcagccac
cacagcataaagtcctacaggaccatcctcccagcggccgcttacaacatctactaccgg
gacagcaacgggaacatttccacgtcgcaagtccgcacccgcaaggactggatcgagctg
gaattgaggccccggtttccgctgtttgggggctggcgcagctcgtacaccctcggctac
agcgtcccgagctatcagtacttgtaccggaagtccagcaccgaatacgtcctcaatatg
cgactgcttgaccacgttttcgacgacatgcatgtagaggagttggagacgaaagttgtt
ttgccggttggagtgaccgaggttcaaatcaaaaccccctacgaagtccagaggctgcct
gatggggtcaccttcaagtacttggatcagttcggcaggagcgtcatcaaactgaggaag
accaatttggtggagcaacacattcaagatttagaaattgtctatcactggaggtcgggg
ttattgcttttggagcccgtcttgttggctctcgcactctacgttttgtttattattgtt
ataatatatgtaaggcttgacttctccattcacaaaccagaacacgctaaaaaggaatga

DBGET integrated database retrieval system