KEGG   Tribolium castaneum (red flour beetle): 661713Help
Entry
661713            CDS       T01046                                 

Definition
histone H2B-like
Orthology
K11252  
histone H2B
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Exosome [BR:tca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   661713
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG2
AA seq 139 aa AA seqDB search
MNFTYQSGRKLIDISLVMSPKMSEKSARKAQKIILKSDKKKKRRRKESYAIYIYKVLKQV
HPDTGISSKAMNIMNSYVNDIFERITMEASHLAQYNKRSTITSREIQTAVRLLLPGELAK
HAVSEGTKAVTKYTNSSNA
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcacttatcaaagtggccgaaaactcattgacatttcgcttgtcatgtcgccg
aaaatgagcgagaaaagtgcccgaaaagcgcaaaaaatcatcttgaagagtgataagaag
aagaaaaggcgcaggaaggagagttacgccatttacatctacaaggttctgaagcaggtt
catcccgatactggaatttccagcaaagctatgaacatcatgaacagctacgtgaatgat
atttttgaacgcatcacgatggaagcttcccatttggctcagtacaacaagcgctccacc
atcaccagcagggaaattcaaacagcggttcgcctgcttctgcctggagaattggccaaa
catgccgtgtccgagggcaccaaggccgtcaccaagtacaccaactccagtaatgcataa

DBGET integrated database retrieval system