KEGG   Tribolium castaneum (red flour beetle): 661713Help
Entry
661713            CDS       T01046                                 

Definition
similar to Histone H2B
Orthology
K11252  
histone H2B
Organism
tca  Tribolium castaneum (red flour beetle)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG2
AA seq 178 aa AA seqDB search
MSPKMSEKSARKAQKIILKSDKKKKRRRKESYAIYIYKVLKQVHPDTGISSKAMNIMNSY
VNDIFERITMEASHLAQYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTNSI
LVKWIRYVKKSEQKKSLKDNSVSLLEVIWRDKGTGVGVIPRRQIKAAPFYRVGAKHVA
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccgaaaatgagcgagaaaagtgcccgaaaagcgcaaaaaatcatcttgaagagt
gataagaagaagaaaaggcgcaggaaggagagttacgccatttacatctacaaggttctg
aagcaggttcatcccgatactggaatttccagcaaagctatgaacatcatgaacagctac
gtgaatgatatttttgaacgcatcacgatggaagcttcccatttggctcagtacaacaag
cgctccaccatcaccagcagggaaattcaaacagcggttcgcctgcttctgcctggagaa
ttggccaaacatgccgtgtccgagggcaccaaggccgtcaccaagtacaccaactccatc
ctcgtcaagtggatcagatacgtcaagaagagcgaacaaaagaagtctttaaaagacaat
tctgtgagtttgttggaagtcatctggagagacaaaggtacgggtgtgggtgtaattccg
cgccggcagattaaagccgcccccttctatagagtgggcgcaaaacatgttgcctaa

DBGET integrated database retrieval system