KEGG   Tribolium castaneum (red flour beetle): 661731Help
Entry
661731            CDS       T01046                                 

Definition
cyclin h-like
Orthology
K06634  
cyclin H
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:tca00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    661731
  Replication and repair
   03420 Nucleotide excision repair
    661731
Transcription machinery [BR:tca03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     661731
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG7
AA seq 330 aa AA seqDB search
MFSTSTQCKNWMFNSEDELNKLREAANLKHIQAYGRHINEAARFEFFLTAEEEKIMVKRY
EIRLRDFCKRFQPPMTRCVIGTAFHYFKRFYIHNSVMNHHPKEIMVTCIYLACKVEEFNV
SIQQFVANLKGDREKATDIILNNELLLMEQLNFQLSIHNPFRPVEGLLIDIKTRCALNDP
ERLRPGTEHFLERAFLTDVVLLYSPSQVALAAVLHAASKLQENLDSYVTDTLFGVEGSGK
LAELIEAVRAIRSIVKMVDATPDKNQQKLLDKKLEKCRNPENNPDSEIYKKRMQALLDED
DDLYHRISTRTDSLDNSALGMSVGGSPEVA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgttttccacgagcacgcagtgtaaaaattggatgtttaacagcgaagatgagttaaat
aaattacgcgaagctgcgaatttgaagcatatccaagcctacggccgccacatcaatgaa
gccgctcgtttcgagttttttctcactgccgaggaggaaaagataatggtgaaacgttac
gaaatccgattacgcgatttttgtaaacggtttcaacctccgatgacgcggtgtgtgatc
gggactgcgttccattatttcaagcgtttttacattcacaattcggtaatgaaccaccat
cctaaggagataatggtcacgtgtatttatttagcgtgtaaggttgaagagttcaatgtt
tccattcagcaatttgttgccaatctcaaaggcgacagggagaaggccactgatattatt
ttgaacaacgagttgttgctgatggagcagctgaatttccagttgtcgattcacaatccg
ttcaggccagtggagggactactaattgatattaaaactagatgtgcattaaatgatcct
gaacgtttaaggcctggaactgaacattttctcgagagagcatttttaacagacgttgtg
ttattgtattctccgagtcaagtggcactagctgctgttttacacgcagcctcaaaattg
caagaaaatttagattcttacgtcactgatacactatttggggttgagggaagtggcaaa
ttggctgaattaattgaagccgtgcgagctatccgatctattgttaaaatggtcgacgct
acgcctgataaaaatcaacagaaacttttagacaagaaattggagaagtgtaggaatcct
gaaaataatcccgatagtgaaatatataagaaacgaatgcaggctttgctggacgaagat
gacgatttgtatcaccgtatttcgacaaggactgattctttggataactccgccttaggc
atgtcagtgggtggttcacccgaagtagcgtaa

DBGET integrated database retrieval system