KEGG   Tribolium castaneum (red flour beetle): 661747Help
Entry
661747            CDS       T01046                                 

Definition
eukaryotic translation initiation factor 3 subunit 1-like
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tca00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    661747
Translation factors [BR:tca03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    661747
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG7
AA seq 230 aa AA seqDB search
MESWDDDNFEPPSVTPVVASNKWEGEDEDDNVKESWEDEEEEKVEAAPAEEAKPKPKKQS
IADKIAEKERKRKEEMERRLREQQEEEISPEEKLRMQKESDLKIALETTFGGDTNSTNIS
GLDGLTLPTTKEEFQDFTDALSKKLQPLAKSTEYPVFTENLLRNLCATLSSLDIKKIKNT
LDNLYLEKQKIEKGEKSKKNKGKGKAKLRLDDGNPLSAYVNDYDDYDDFM
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgtgggacgacgataacttcgaacctccatctgttacacctgtggttgcgtcc
aacaaatgggaaggcgaggacgaagacgacaacgtcaaggaaagctgggaggatgaggag
gaggagaaggtggaagcggcgcctgccgaggaggccaaacccaagcccaagaagcagtca
atcgctgacaaaatcgcagagaaagaaagaaagaggaaggaagaaatggagcggaggctg
agggagcaacaggaggaggaaatctccccggaggagaagctcaggatgcagaaggaatcg
gacttgaaaatagcgctagaaacgacgtttgggggcgacaccaatagcacaaacatttca
ggtttagacggactcacgctgccaactactaaagaagagtttcaggactttacagacgct
ctctctaagaagctccaacctctagctaaaagcacagagtatccggtgttcaccgaaaac
ttactacgaaatctgtgtgccactttgtcctcattagatattaagaaaattaaaaatacg
ttagataatttatacctagagaaacaaaaaatcgagaaaggcgagaaatcgaagaaaaac
aaaggcaaaggcaaggctaaattacgactggatgatggaaatcctttgtcagcgtatgtt
aacgactatgacgattacgacgactttatgtag

DBGET integrated database retrieval system