KEGG   Tribolium castaneum (red flour beetle): 661869Help
Entry
661869            CDS       T01046                                 

Definition
similar to Alkaline phosphatase, tissue-nonspecific isozyme precursor (AP-TNAP) (Liver/bone/kidney isozyme) (TNSALP)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    661869
Enzymes [BR:tca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     661869
Exosome [BR:tca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   661869
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG1=X; LG2
AA seq 574 aa AA seqDB search
MLAKFWIQCLCSLTVFVQCSWTAATVSQSTIHDQEYWYEQARIALRKRLQYATDRRPHAK
NVVLFVGDGMGVATATAARILRGQRLGKRGEDHELAWDTFPAVAFAKTYNMDAQIGESSA
CATALMCGVKTNFETVGLDARGRFENCFSSFSSRVSSLIDWAQESGKSTGIVTNTRITHA
TPAALYGHSPSRYWEDDSKVPPASRKSCKDLARQLIENDPGRNINVLLGGGRRHWLPKVA
HDPEQTKEEGRRLDGRNLIDDWVRDKKKRGLKAEYVWNKGQLDKINPNQVDYLLGLFAYS
HMDFEADRDAGPSGDPSLADMTRSALSILLKNPKGFFLFVEGGRIDHAHHYNNAYRALDE
TLAMETALLAALALINPTETLIVVTSDHSHVLTMGGQATPRGHPILGPDSKVSDIDGQPY
TTILYGNGPGYATPRIVPMNTTTASEDRNQVHGSAVPRQWATHGGEDVPVYALGPLATTL
FTGTFDQSYIPHAIAYSACLAEHRLRCQGIDNYTAPQVTTCVAPEVSSVSAAGAPVVIAS
SVMADDGTRVKSGVGHMGATQGVLLAVMLEFAVT
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgttggccaagttttggatacagtgtttgtgcagtttgacagtatttgtgcagtgttct
tggacggctgccacagttagtcaaagtaccattcatgaccaggaatattggtacgaacaa
gcacgaatcgctttgcggaagagactgcaatatgctaccgaccgccggccacatgccaag
aatgtggtgttgtttgtgggtgatgggatgggcgtagccacggccactgccgccaggatc
ctgagaggacaacggctgggaaaaaggggagaggaccacgagctcgcctgggacaccttc
ccggccgtggccttcgctaagacttacaacatggacgcccagataggagagtcatcagca
tgcgctacggcgttgatgtgcggcgttaaaacaaactttgaaacggtcggtttggatgct
cgaggtcgtttcgaaaactgtttttctagcttctcttcacgagtctcatcgctgatagat
tgggcacaagagtcagggaaatcgacaggaattgtgacaaacacccgaataactcacgcc
acacccgcagctctgtatggtcattctccgtcacgctattgggaggacgattcgaaagtt
ccgccagcgtctcgaaaatcctgcaaggatttagctcggcaactcatcgaaaatgatcct
ggacggaacatcaacgttttgttgggcggcggaaggcgacactggttgccaaaagttgcc
cacgatccagaacaaactaaagaggaaggtcggcgcctcgatggacgtaatctcatcgat
gactgggttcgagataagaaaaagcgtggactcaaagctgaatacgtctggaataaagga
cagctcgataaaattaaccccaatcaagtcgactacttgctcggtttattcgcttattcg
cacatggattttgaagccgatcgtgacgctggcccttctggggatccctccctggctgat
atgacgcgttcagccctttccatcctgttgaaaaatccgaaaggcttcttcttgttcgtc
gaaggaggacggatcgatcacgcccaccattacaacaacgcttacagggctttagacgaa
acgctggcgatggagacggcccttctggcggctctggccctcataaacccaacagagacg
ttaattgttgttacttcggatcattcgcacgtcctcacgatggggggccaagccacgccg
agaggacacccgatcctaggtcctgacagcaaagtatccgacatcgacggccaaccctac
accaccatcctctacggcaacggccccggctacgccacccctcgcatcgtgcccatgaac
accaccaccgcttccgaagaccgcaaccaggtgcacggctcggctgtgccccggcaatgg
gccacccacggcggcgaggacgtgcccgtctatgcactaggtcccctggccaccaccctc
ttcaccgggaccttcgaccagagctacatcccgcacgccatcgcttacagcgcctgtttg
gccgaacatcgcctgcgctgccagggaatcgacaattacaccgccccccaggtgaccacg
tgcgtcgctccggaagtgtcgagcgtttccgctgccggagctccggtggttatcgccagc
agcgtgatggccgatgatgggacgagggttaagtcgggggtggggcacatgggggccacc
cagggggtgctcctggcagtgatgctggagtttgctgttacgtaa

DBGET integrated database retrieval system