KEGG   Tribolium castaneum (red flour beetle): 661871Help
Entry
661871            CDS       T01046                                 

Definition
NAD-dependent protein deacetylase Sirt6
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Enzymes [BR:tca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     661871
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG2
AA seq 338 aa AA seqDB search
MSCNYADGLSPYEHKGVLGAPERFDPPERVQEKCEMLADWIRNARHVVLHTGAGISTSAG
IPDFRGPNGVWTLEKQGKKPNIDISFKDAIPTKTHMAIKKLVEENYVHYIISQNIDGLHL
RSGITRKYIAELHGNMFVEQCNFCDSQFVRNLPTATVGKKCLEINCKRILRGRPCRGKLC
DTILDWEHNLPEKDLEMSDYHSSVADLNICLGTTLQIVPSGNLPLRCKKFGGKVVIINLQ
PTKHDKKADLIINTYVDDVLEKVMKRLGLEIVEYCEKGDPTMNPLEGLNWNITKCNIKEV
KALYDLYCKKTKKRKLEMKKQRDSKTKKEEKTEIIDLM
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgtaattacgccgatggattgtctccttacgagcataagggtgtgttaggggcc
cctgagcgttttgacccccctgagagggtgcaagaaaagtgcgaaatgttagctgactgg
attcgaaacgcaagacatgtcgtactgcacacaggtgcaggtattagcacttctgcaggt
attccagatttcagggggcctaatggagtctggactttggaaaagcaaggcaagaagcca
aacattgatatctctttcaaagacgcgattccgacgaaaacccacatggctataaaaaaa
ctggttgaagaaaattatgtccattacataattagccaaaatattgacggtttgcatttg
agaagtggaatcaccaggaaatacattgcagaattgcacggaaatatgtttgttgaacaa
tgcaatttttgcgacagccagtttgtgcgtaatttgccaactgcgactgttggaaaaaaa
tgtctcgagattaattgtaagaggatactgagggggagaccttgcagggggaaactgtgt
gatacaatccttgactgggaacacaacttgcctgaaaaagatttggaaatgtcagactac
cactccagtgtggcagatttaaatatttgtttgggcactactttacaaatcgttccgagc
ggaaatttgccactcaggtgcaaaaagttcggggggaaagttgtcataatcaacttgcaa
cctacaaaacacgacaaaaaggctgatttaataattaacacttatgttgacgatgtgttg
gaaaaagtcatgaagagattgggattagaaatcgtagaatattgcgaaaaaggcgatcct
acaatgaatcctcttgaaggacttaattggaacatcacaaaatgtaatattaaagaagtc
aaggcgctgtatgacttgtactgtaagaaaacaaagaagagaaaactggaaatgaagaaa
caacgtgactctaagacgaaaaaagaagagaaaaccgaaatcattgatttaatgtaa

DBGET integrated database retrieval system