KEGG   Tribolium castaneum (red flour beetle): 661995Help
Entry
661995            CDS       T01046                                 

Definition
MAP kinse-ERK kinase-like
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Dorso-ventral axis formation
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - fly [PATH:tca04013]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:tca04068]
Organismal Systems; Development; Dorso-ventral axis formation [PATH:tca04320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG1=X
AA seq 386 aa AA seqDB search
MSKNKLNLTLPPGSLDQTPTVTPTSAPFPDAAAPSNNVGGSSIDNLTARIEGLEMDATQR
RRIEVFLCQKEKIGGDLSDDDLEKLGELGSGNGGVVIKVRHKSGLIMARKLIHLEVKQAI
KLQIIRELKVLHECNFAHIVGFYGAFYSDGEISICMEYMDAGSLDLILKKAGRIPENILG
KITVAVLKGLSYLRDKHAIMHRDVKPSNILINSSGEIKICDFGVSGQLIDSMANSFVGTR
SYMSPERLQGTHYSVQSDIWSLGLSLVEMAIGMYPIPPPDPETLKAMFESRNDNDSPDHT
KGPRPMAIFELLDYIVNEPPPKLPSGLFSDEFKDFVDRCLRKNPDERADLKTLMNHEWIK
KAEAEDVDIAGWVCKTMEIQPPQNKV
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagaacaagctaaacctgaccctccccccgggttcgctggaccaaacccccacg
gtgacccccacaagtgcgccgtttccggacgccgcagccccgtcgaacaacgtcgggggc
tccagcatcgacaacctaacggcccggatcgagggcttggagatggacgccacgcagagg
aggcgcattgaggtgttcctgtgccagaaggagaaaatcgggggtgatttgagcgacgac
gatttggaaaaactgggcgagttggggtcggggaacggcggcgtcgttattaaagtccgc
cataaatccgggctcatcatggcccggaaattaatccacttggaggtgaaacaggcgatc
aaactccagataattcgcgaattgaaagtcttgcacgagtgcaatttcgcgcacattgtg
ggcttctacggcgcgttttacagcgatggggagatcagcatctgtatggagtatatggac
gctgggtctttagacttaattcttaaaaaagccggacggattcccgaaaatatactcggg
aagattaccgttgcggttttgaaggggctgagctacttgagggataaacacgcgattatg
caccgcgatgttaagcccagtaatatactcattaatagtagcggcgagatcaagatttgt
gattttggggtctcgggacaacttatagactcgatggcgaactctttcgtcggaacgaga
agctacatgtcgccggagagactccaaggaacgcattactcagtccaaagtgatatttgg
tctctcggtttatcactagtggagatggcaatcggcatgtacccaatcccacctcctgat
ccagaaacgttgaaagcgatgtttgagtcgcgaaacgacaacgattcacctgaccacact
aaagggcctcgccctatggcaatcttcgagcttctggactacatcgtcaacgagcctccg
ccgaaactgccaagcgggttattttcagacgaattcaaagattttgttgataggtgttta
agaaaaaatccggatgaaagggccgacttgaaaaccttgatgaaccacgaatggatcaaa
aaagccgaagccgaggacgtggacatcgccggttgggtttgtaaaacaatggaaattcaa
ccgccacaaaataaagtataa

DBGET integrated database retrieval system