KEGG   Tribolium castaneum (red flour beetle): 661995Help
Entry
661995            CDS       T01046                                 

Definition
MAP kinse-ERK kinase-like
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:tca00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    661995
   04068 FoxO signaling pathway
    661995
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    661995
Enzymes [BR:tca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     661995
Protein kinases [BR:tca01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   661995
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG1=X
AA seq 386 aa AA seqDB search
MSKNKLNLTLPPGSLDQTPTVTPTSAPFPDAAAPSNNVGGSSIDNLTARIEGLEMDATQR
RRIEVFLCQKEKIGGDLSDDDLEKLGELGSGNGGVVIKVRHKSGLIMARKLIHLEVKQAI
KLQIIRELKVLHECNFAHIVGFYGAFYSDGEISICMEYMDAGSLDLILKKAGRIPENILG
KITVAVLKGLSYLRDKHAIMHRDVKPSNILINSSGEIKICDFGVSGQLIDSMANSFVGTR
SYMSPERLQGTHYSVQSDIWSLGLSLVEMAIGMYPIPPPDPETLKAMFESRNDNDSPDHT
KGPRPMAIFELLDYIVNEPPPKLPSGLFSDEFKDFVDRCLRKNPDERADLKTLMNHEWIK
KAEAEDVDIAGWVCKTMEIQPPQNKV
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagaacaagctaaacctgaccctccccccgggttcgctggaccaaacccccacg
gtgacccccacaagtgcgccgtttccggacgccgcagccccgtcgaacaacgtcgggggc
tccagcatcgacaacctaacggcccggatcgagggcttggagatggacgccacgcagagg
aggcgcattgaggtgttcctgtgccagaaggagaaaatcgggggtgatttgagcgacgac
gatttggaaaaactgggcgagttggggtcggggaacggcggcgtcgttattaaagtccgc
cataaatccgggctcatcatggcccggaaattaatccacttggaggtgaaacaggcgatc
aaactccagataattcgcgaattgaaagtcttgcacgagtgcaatttcgcgcacattgtg
ggcttctacggcgcgttttacagcgatggggagatcagcatctgtatggagtatatggac
gctgggtctttagacttaattcttaaaaaagccggacggattcccgaaaatatactcggg
aagattaccgttgcggttttgaaggggctgagctacttgagggataaacacgcgattatg
caccgcgatgttaagcccagtaatatactcattaatagtagcggcgagatcaagatttgt
gattttggggtctcgggacaacttatagactcgatggcgaactctttcgtcggaacgaga
agctacatgtcgccggagagactccaaggaacgcattactcagtccaaagtgatatttgg
tctctcggtttatcactagtggagatggcaatcggcatgtacccaatcccacctcctgat
ccagaaacgttgaaagcgatgtttgagtcgcgaaacgacaacgattcacctgaccacact
aaagggcctcgccctatggcaatcttcgagcttctggactacatcgtcaacgagcctccg
ccgaaactgccaagcgggttattttcagacgaattcaaagattttgttgataggtgttta
agaaaaaatccggatgaaagggccgacttgaaaaccttgatgaaccacgaatggatcaaa
aaagccgaagccgaggacgtggacatcgccggttgggtttgtaaaacaatggaaattcaa
ccgccacaaaataaagtataa

DBGET integrated database retrieval system