KEGG   Tribolium castaneum (red flour beetle): 662050Help
Entry
662050            CDS       T01046                                 

Definition
glycogen synthase-like
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    662050
Enzymes [BR:tca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     662050
Glycosyltransferases [BR:tca01003]
 Polysaccharide
  Storage polysaccharide
   662050
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG6
AA seq 691 aa AA seqDB search
MSREKASSRRFYRSESYFNLMACMDRGTQAEEENRWTFEIAWEAANKVGGIYTVIRSKSY
VSTEEMGDQYCLIGPYKEFHARTEVEEGPLGSDPLNEAVQALRDKGFKVHTGRWLVDGNP
QIILMDIGSAAWKLDEYKTELWEKCNVGVPHLDVEANDAIILGNMVADFIANFKNCADRY
GDGIPARIVTHFHEWQAGVGLITLRTRLVKVATVFTTHATLLGRYLCAGNTDFYNNLDKF
VVDEEAGKRQIYHRYCIERAATHLAHVFTTVSDITGFEAEHLLKRKPDVITPNGLNVKKF
SALHEFQNLHAISKEKIHEFIRGHFYGHYDFDLDKTLYFFIAGRYEFSNKGADIFIEALA
RLNHYLKSTHPDITVVAFLIFPTRTNNFNVESLRGHAVTKSLRDTISDIQTRIGRRMYEV
CLSGHLPGDDLLKKEELVRLKRCIFSLQRDGLPPVTTHNIVDDWNDPVLASVRRCNLFNT
KYDRVKIVFHPEFLSSTNPLFGLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSIT
TNLSGFGCFMQEHIADPMSYGIYVVDRRYISLEASVQQLAQYMYDFARLNRRQRIIQRNR
TERLSDMLDWRSLGVYYRQARMKALHSVFPDYKEEMDNGIATLKYPRPISEPPSPSSSRV
TTPAASLHGSDDESDSVDEERELEELKINHH
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgtgaaaaagcatcttcgaggaggttttaccgctccgagtcctacttcaacctt
atggcctgtatggacaggggcacccaagccgaggaggagaaccgatggacttttgaaatc
gcctgggaggcggccaataaagttggggggatttacacagtaattcggtcaaaatcgtac
gtctcgactgaagaaatgggggaccagtactgtcttattggcccctataaggagtttcat
gcacggactgaagtcgaagaggggcccctaggttcggacccgctcaatgaagccgtgcaa
gctttacgcgacaagggctttaaagtgcacaccggccgttggcttgtcgatgggaatccc
caaataattctcatggatatcggctcagcggcgtggaaactcgacgaatacaaaacggaa
ttgtgggaaaaatgcaatgtgggagtcccccatttagacgtcgaagccaacgacgccatt
atcctcggcaatatggtggccgatttcattgccaactttaaaaattgcgctgatcgctat
ggtgacggcataccggcccgaattgttacgcattttcacgaatggcaagccggggtcggg
cttataactttacggacacgactggttaaggtggcaacagtgtttaccacacatgcgact
ttactgggtcggtatctgtgtgccggtaatacagatttctataataatttggataagttt
gttgtggatgaagaggcggggaaaaggcaaatttatcataggtattgcatcgagagggcc
gccacgcacctcgcacatgtttttaccacagtgtcggatattacaggctttgaggccgag
catttactcaaacgcaaaccggacgtgatcactccgaacggcctcaacgtgaaaaaattc
tccgccttgcacgaattccagaacctgcacgccatctccaaggagaaaattcacgaattc
atccgcggccatttctacggccactacgacttcgacctcgacaaaaccttgtattttttc
atcgccggtcgttacgagttttccaacaagggcgccgacatcttcatcgaggccttggcg
cgcctcaaccactacctcaagtccacgcacccggacatcaccgtcgtcgccttcctcatc
ttccccacgcgcaccaacaacttcaacgtggagtcgctgcgcgggcacgccgtcaccaag
agcctccgggacaccatcagcgacatccagacccgcatcggcaggcgcatgtacgaggtc
tgcctcagcggccacctccccggggacgatctgctcaaaaaggaggagctggtgcgcctg
aagcggtgcattttctccctccagagggacggtctgccgccggtcaccacgcacaacatc
gtggacgactggaacgacccggtgctggcgagtgtccggcggtgtaatttattcaacacc
aagtatgatagggttaagattgtttttcacccggagtttctctcctcgacgaacccgctt
ttcgggctggattacgaggagttcgtgcgtgggtgccatttgggggttttcccgagctac
tacgagccgtgggggtacacgccggctgagtgcacggttatgggaatccccagtattacg
acgaatttgtcagggttcgggtgcttcatgcaggagcatatcgccgatccgatgtcctac
gggatttatgtcgtggatcgtcggtatatttcgttggaggcttcggtgcaacaattggcg
cagtatatgtacgattttgcacgattgaatcgaaggcagaggatcattcagaggaatagg
acggagaggttgagcgatatgctggattggaggagtctaggagtgtactaccggcaggcg
cgtatgaaggccctccacagcgttttcccggactataaggaggagatggacaatggtatc
gcgactttgaaatatccgaggcctatttcagagcctccttctcctagttcaagtcgggtg
actacgccagcggcgtcccttcatggcagtgatgatgaaagcgattcggttgatgaagaa
cgggaattggaagaattgaaaataaatcatcactga

DBGET integrated database retrieval system