KEGG   Tribolium castaneum (red flour beetle): 662090Help
Entry
662090            CDS       T01046                                 

Definition
pyruvate dehydrogenase kinase-like
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
tca  Tribolium castaneum (red flour beetle)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG7
AA seq 421 aa AA seqDB search
MRLTAKACQSIAKMLDFYSQFNPSPLSIKKFIDFGLNASEQKSFIFLRKELPVRLANIMK
EIALLPENLLRMPSVVAVNDWYIRSFQEIIEFEKKEINHDTLNYFCDSLVKIRNRHADVV
ETMAQGVLELKESHDVDHQTEHSIQYFLDRFYMSRISIRMLINQHTLLFGGQLENAPGPN
QSKYIGCIDPQCDIVSVIKDAYENARFLCDQYYLASPDLIINQSQHNELQQEGRINIVYV
PSHLYHMLFELFKNAMRAVMEYHVSNDKYPPITVTIAKGKEDISLKMSDRGGGIARSTTE
HLFKYMYSTAPQPSKSDAHTVPLAGYGYGLPISRLYARYFHGDLVLMSCEGDGTDAVIYL
KALSNEANELLPIFNKTTSKFYRTMVQTGDWSNQAANVSQRTISTHYKKHQLPQESMTGA
I
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgagactgacagcgaaggcatgtcaaagcattgcaaaaatgctggatttctactcccaa
ttcaacccgtcacccttatccataaagaaatttatagatttcggcttgaatgcctccgag
caaaaatcgttcattttcctacggaaggaactgccggtgcgtttggccaacatcatgaaa
gagatcgcccttctgcctgaaaatctcctgagaatgccgtcagtggtcgccgtcaacgat
tggtacatccgcagtttccaggaaatcatcgagttcgaaaagaaggaaatcaaccacgat
accctcaactacttctgtgatagtttagtgaaaatccgtaatcggcatgccgacgttgtc
gaaacgatggctcagggagtcctcgaattgaaggaatcgcacgatgttgaccatcaaacc
gagcacagcattcagtatttcttggaccggttctatatgtcgaggatatcgattcgaatg
ttgatcaatcagcacacacttttatttgggggacaattggagaatgcaccaggacccaac
caaagcaaatacattggctgtatcgatccacagtgtgatatcgtaagcgttattaaagac
gcctacgaaaacgcacgctttctgtgtgatcaatattacttagcttcgcctgacttaatc
atcaaccaatcgcaacataatgaattgcaacaagaaggacgaattaatatagtctatgtc
ccctcacatctttaccacatgctgttcgagctgttcaagaatgcaatgagagcggttatg
gagtatcacgtgtccaatgacaagtatcctccaatcacggtcaccatagccaaggggaag
gaagacatctcgctcaagatgtcggaccgaggcgggggcatcgcccgttccaccacggag
cacctgttcaaatacatgtactcgacagccccccagcccagcaaatcggacgctcacaca
gtcccattggcgggttatgggtacggtttgcccatttctagattatatgctcggtatttc
cacggagacctagttttgatgtcgtgtgaaggcgatgggaccgatgctgttatctatctc
aaagctttgtcgaatgaagcgaatgaattgcttccaatcttcaataaaaccacatcgaag
ttttatcgaacgatggtacaaactggtgattggtccaatcaggctgctaatgtgagtcag
aggacaatcagcacgcactataagaaacaccaactgccgcaggaatcaatgacaggggct
atatag

DBGET integrated database retrieval system