KEGG   Tribolium castaneum (red flour beetle): 662194Help
Entry
662194            CDS       T01046                                 

Definition
similar to CG7793-PA
Orthology
K03099  
son of sevenless
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Dorso-ventral axis formation
Jak-STAT signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - fly [PATH:tca04013]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:tca04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:tca04068]
Organismal Systems; Development; Dorso-ventral axis formation [PATH:tca04320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG6
AA seq 1252 aa AA seqDB search
MNTVNAGDNFYDFTNEENSAKWKGVLTTALKRVLEQVHPSLDAREDALEYVENLCLRLLA
MLCAKPSPHTVQDVEYRVQSTFPTPIDKWALKEAQGALDRGKKKSVLLLPVDKIHSLLQK
ELLLYKVDSTVSLFLVAVLEYISADILKLAGNYVKNIKHFEITYQDVQISMNADKALMDM
FYQDEGGGPGLPTESLLVSSAPRTSLTYEEVVRELIASEKAYIKELHMLIKVFREEIIKL
SSDSTEIELIFSNIMDIYELTYTLLGSLEDVIEMAQDQMSYIGSCFEELAEAAEFDVYIK
YAKDVTAPTCRSTLNSLLSRPDVENALISAGQGMRLALKYYLPALLMGPIRHCFSYIEYI
TILRGLSVAPEDRETLTQVEGLLKPLQIELSRCVPSPAMLRSCSTPFLQVRARRQAALDK
LHEIEKNVENWDPKDLGQCCNEFVREDVLMKVSSGKRLTERRVFLFDGLLILCKPNSRRQ
SSVHQNHAECRLKERFFIRKVEIIDHLDTEELKNAFEIAPRHMQPSVILCAKTAEEKNSW
MADLVMLNTRSMLERILDSILSDIERKHPLKLPPPSLYKFAEPDSKDNIILEQRENGGVP
LIKGATLYKLVERLTYHIYADPKFVRTFLTTYRSFCSPKELLDLLIERFQIPDPSLVYEQ
ECCDTDKMQKNNQREDWKKYRKEYVQPVQFRVLNVLRHWVDHHFYDFERDPTLLVKLRDF
LDAVNGKSMRKWVDSVLKILHRKMENDNQRHIRFAFDEPPPPIEWHIPCTEEEYGILTLH
PVEIARQLTILEFDLYRMIKPSELVGAVWTKKDKETTSPNLLKMIKHTTNVGRWLEKNIV
EAENFEERVAILNRIIEIMIVLYEINNFNGVLSIVSTCASASVHRLKLTFAALTQQNKKA
LEECRADDHFKKYQEKLRSINPPCVPFLGMYLTNILHIEEGNPDFLPNTQLINFFKRRKV
AEITGEIQQYQNQPYCFSVESKIRHFLENLNPFGDLSDTEISNYLYNKSMEIEPRGQKQV
QKFPRKWPHLSLKSPGIKSKAKTTATAVTNAINSTLNSSNIKSDDSKSEDSSKSDNEFSV
FAPVQLGTCQNSPTLSPVSPATSNTILSWFQPNHNRSPSVGSIMSTTSMRNPPPPPPQAS
KYQHYSQSSTGGSNSPGPHSPASPGPVQSYEPNSPRRPLTPPPPPPPLPPRRRRDSPEIK
FLRTNQRVFRHGMTRPRLGCRPGRRPGPPTWSRDPCSNTRALPQLNEGGASK
NT seq 3759 nt NT seq  +upstreamnt  +downstreamnt
atgaatactgtcaatgccggcgacaacttttacgatttcaccaatgaggaaaattcggcc
aagtggaaaggagtgctcaccaccgccttgaagcgggtgctggagcaggtgcacccgtct
ttggacgcccgcgaagatgccctcgaatacgtcgaaaacctctgtttgcgccttctggcc
atgctctgcgccaaacctagtccacacacagtccaggatgttgaatatagagtacaaagc
acgtttcctacccccatcgataagtgggccttgaaagaggcccaaggcgccctcgatcga
ggcaaaaagaagtccgttttgctgttgccagttgacaaaattcacagtttattacaaaag
gaattgctattgtacaaagtcgactcgaccgtctccctctttctagtcgctgttttggag
tacatttcggccgatattttaaaattggcgggaaattacgtgaaaaacatcaaacatttc
gaaatcacctaccaggatgtccagatttcgatgaatgcggataaggcactcatggatatg
ttctatcaagatgaaggagggggacctggtttaccgactgagtcgcttttagtgtcgtcg
gctccgcgcacgagtctcacgtatgaggaagtcgtaagagagttaatagcttcggaaaaa
gcatacatcaaagaactacacatgttgatcaaagtgtttcgcgaggaaattatcaaacta
agctccgattcgaccgaaattgaactgattttttcgaacattatggatatttacgaactg
acgtatactctattgggtagtttggaggacgtcatcgagatggcgcaagaccaaatgtcg
tacattggcagctgtttcgaagagctggccgaagccgccgaattcgacgtgtacataaaa
tacgcgaaagacgtaaccgcccccacatgtcgctccaccctcaacagcctcctctcgcgc
cccgacgtcgaaaacgcgctcatctcagccggtcaaggcatgcgtctcgccctcaagtat
tacctgcctgcgcttctaatgggccccatccgacactgcttctcctacatcgaatacatc
accattttacggggcctgtccgtggcccccgaagaccgcgaaaccctcacccaagtcgaa
ggcttactcaaacccctccaaatcgagctctcccggtgcgtcccctcccccgccatgctg
cgcagctgctccacccccttcctccaagtgcgggcgcgccgacaagccgccttggataaa
ctgcacgaaatcgagaagaacgtcgaaaattgggacccgaaggatttgggacagtgttgc
aacgagttcgtgcgagaggacgtcctgatgaaagttagttcagggaaacgcttaaccgaa
cgaagagttttcctcttcgacggtttactcatcttgtgtaaaccgaactcaagacgacag
agttccgttcaccaaaaccacgcagaatgtcgcttaaaggagcgttttttcatccgaaaa
gtcgaaatcatcgatcacttggacaccgaagagttgaagaacgcgttcgaaatcgcgcca
agacacatgcaaccgtcggtgattttgtgtgcgaaaacagccgaagagaaaaactcgtgg
atggccgacttggtgatgttgaacacgcgctcgatgttggaacgcatccttgatagtatt
ttgtcggatattgagcggaaacacccccttaaacttccaccgccgtctttgtacaaattt
gcggagcccgactccaaggacaacatcatcctcgagcagcgcgagaacggaggtgtgccc
ctgatcaagggcgcaacactgtataaacttgttgaaagactgacttatcatatttacgcc
gatccgaaatttgtgcgcacgtttttgacgacgtatcggagtttttgttcgccgaaggag
ttgctcgatttgctcattgaacgatttcaaattcccgatccgtcgctggtttatgagcag
gagtgttgcgacacggataaaatgcagaaaaataatcaaagggaggattggaaaaagtac
aggaaggagtacgtgcagccggtgcagttccgagtgttgaatgtgttgaggcattgggtt
gatcatcatttttatgatttcgagcgggatcccacacttttggttaaattgagggatttt
ctggatgcggtcaacgggaagagcatgaggaagtgggtggacagcgtgctcaagatattg
cacagaaagatggaaaacgataatcagcgacacatccgcttcgccttcgacgagcctccg
cccccgatcgaatggcacatcccttgcaccgaagaagaatacggaattctaaccctccac
cctgtcgaaatcgcacgccaactaacaattctcgaattcgatctgtaccgaatgatcaaa
ccttccgaactagtcggagccgtttggacaaaaaaagacaaagaaacgacaagtccgaat
ttactcaaaatgatcaaacacacaactaatgtgggccgctggttggagaaaaacatcgtc
gaggcggaaaatttcgaagaacgcgtcgcaatcctaaaccgaataatcgaaataatgata
gttttatacgaaataaataatttcaacggagtcttgtcgatcgtctcgacttgtgcctcg
gcctccgttcatcgcctcaagctgactttcgccgcgctgacgcaacagaacaagaaggcg
ctggaggagtgccgagccgacgaccatttcaaaaaataccaagagaaactacgctccatc
aacccgccctgtgtccccttcctgggcatgtacctcaccaacatcctccacatcgaggag
ggcaatcccgacttcctccccaacacccaactcatcaacttcttcaagcgccgaaaagtc
gccgaaatcaccggagaaatccaacaataccagaaccaaccgtactgtttcagcgtcgaa
tcgaaaatccgccacttcctcgaaaacctcaacccgttcggcgacctctccgacaccgaa
atcagcaactacctgtacaacaagtcgatggagatcgagcccagaggccagaaacaagtc
cagaaattcccccggaaatggccacatctgagcctcaaaagtccgggcattaaatcaaag
gcgaaaaccacagccacggcggtcacaaatgcgattaattccaccctgaattcgtcaaac
atcaagagcgacgactcaaagagcgaagattcctcgaaatcggataacgagtttagcgtt
tttgcgcccgttcagttgggcacctgccagaacagccccaccttaagcccggtctcgcca
gccacatccaacaccatcctgagctggttccagcccaaccacaaccgcagccccagtgtg
ggctccatcatgtccacgacgtcgatgcgcaatccgcccccgccgcccccacaagcgtca
aagtaccaacactatagccaaagctcgacggggggctcgaacagcccggggccgcacagc
cccgcctcgcccggccccgtccaatcctacgaacctaacagtccgcgccgtccgctaacc
ccgcccccgcctccgcccccgctcccgccccggcggcgccgcgacagccccgaaatcaag
ttcctcagaaccaaccagcgagtatttcgccacggtatgactcggccacgcctcggctgc
cgcccaggccggcggcccggtccgccgacatggtcacgggacccatgttccaatacccga
gcactaccacaacttaatgagggaggggcttccaaataa

DBGET integrated database retrieval system