KEGG   Tribolium castaneum (red flour beetle): 662194Help
Entry
662194            CDS       T01046                                 

Definition
protein son of sevenless
Orthology
K03099  
son of sevenless
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Dorso-ventral axis formation
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:tca00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    662194
   04630 Jak-STAT signaling pathway
    662194
   04068 FoxO signaling pathway
    662194
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    662194
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG6
AA seq 1329 aa AA seqDB search
MMNTVNAGDNFYDFTNEENSAKWKGVLTTALKRVLEQVHPSLDAREDALEYVENLCLRLL
AMLCAKPSPHTVQDVEYRVQSTFPTPIDKWALKEAQGALDRGKKKSVLLLPVDKIHSLLQ
KELLLYKVDSTVSLFLVAVLEYISADILKLAGNYVKNIKHFEITYQDVQISMNADKALMD
MFYQDEGGGPGLPTESLLVSSAPRTSLTYEEVVRELIASEKAYIKELHMLIKVFREEIIK
LSSDSTEIELIFSNIMDIYELTYTLLGSLEDVIEMAQDQMSYIGSCFEELAEAAEFDVYI
KYAKDVTAPTCRSTLNSLLSRPDVENALISAGQGMRLALKYYLPALLMGPIRHCFSYIEY
ITILRGLSVAPEDRETLTQVEGLLKPLQIELSRCVPSPAMLRSCSTPFLQVRARRQAALD
KLHEIEKNVENWDPKDLGQCCNEFVREDVLMKVSSGKRLTERRVFLFDGLLILCKPNSRR
QSSVHQNHAECRLKERFFIRKVEIIDHLDTEELKNAFEIAPRHMQPSVILCAKTAEEKNS
WMADLVMLNTRSMLERILDSILSDIERKHPLKLPPPSLYKFAEPDSKDNIILEQRENGGV
PLIKGATLYKLVERLTYHIYADPKFVRTFLTTYRSFCSPKELLDLLIERFQIPDPSLVYE
QECCDTDKMQKNNQREDWKKYRKEYVQPVQFRVLNVLRHWVDHHFYDFERDPTLLVKLRD
FLDAVNGKSMRKWVDSVLKILHRKMENDNQRHIRFAFDEPPPPIEWHIPCTEEEYGILTL
HPVEIARQLTILEFDLYRMIKPSELVGAVWTKKDKETTSPNLLKMIKHTTNVGRWLEKNI
VEAENFEERVAILNRIIEIMIVLYEINNFNGVLSIVSTCASASVHRLKLTFAALTQQNKK
ALEECRADDHFKKYQEKLRSINPPCVPFLGMYLTNILHIEEGNPDFLPNTQLINFFKRRK
VAEITGEIQQYQNQPYCFSVESKIRHFLENLNPFGDLSDTEISNYLYNKSMEIEPRGQKQ
VQKFPRKWPHLSLKSPGIKSKAKTTATAVTNAINSTLNSSNIKSDDSKSEDSSKSDNEFS
VFAPVQLGTCQNSPTLSPVSPATSNTILSWFQPNHNRSPSVGSIMSTTSMRNPPPPPPQA
SKYQHYSQSSTGGSNSPGPHSPASPGPVQSYEPNSPRRPLTPPPPPPPLPPRRRRDSPEI
SSPQLKTDPHWRECSPPPLPPRRGDPGSSPSSHIQHSHHSFNSFGGGTMPRLNPTHMSQL
HMRRHSTVQPQVPRRTVHANVTPLVPQNQPASISPRYDSATPRLPPRPAARSADMVTGPM
FQYPSTTTT
NT seq 3990 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatactgtcaatgccggcgacaacttttacgatttcaccaatgaggaaaattcg
gccaagtggaaaggagtgctcaccaccgccttgaagcgggtgctggagcaggtgcacccg
tctttggacgcccgcgaagatgccctcgaatacgtcgaaaacctctgtttgcgccttctg
gccatgctctgcgccaaacctagtccacacacagtccaggatgttgaatatagagtacaa
agcacgtttcctacccccatcgataagtgggccttgaaagaggcccaaggcgccctcgat
cgaggcaaaaagaagtccgttttgctgttgccagttgacaaaattcacagtttattacaa
aaggaattgctattgtacaaagtcgactcgaccgtctccctctttctagtcgctgttttg
gagtacatttcggccgatattttaaaattggcgggaaattacgtgaaaaacatcaaacat
ttcgaaatcacctaccaggatgtccagatttcgatgaatgcggataaggcactcatggat
atgttctatcaagatgaaggagggggacctggtttaccgactgagtcgcttttagtgtcg
tcggctccgcgcacgagtctcacgtatgaggaagtcgtaagagagttaatagcttcggaa
aaagcatacatcaaagaactacacatgttgatcaaagtgtttcgcgaggaaattatcaaa
ctaagctccgattcgaccgaaattgaactgattttttcgaacattatggatatttacgaa
ctgacgtatactctattgggtagtttggaggacgtcatcgagatggcgcaagaccaaatg
tcgtacattggcagctgtttcgaagagctggccgaagccgccgaattcgacgtgtacata
aaatacgcgaaagacgtaaccgcccccacatgtcgctccaccctcaacagcctcctctcg
cgccccgacgtcgaaaacgcgctcatctcagccggtcaaggcatgcgtctcgccctcaag
tattacctgcctgcgcttctaatgggccccatccgacactgcttctcctacatcgaatac
atcaccattttacggggcctgtccgtggcccccgaagaccgcgaaaccctcacccaagtc
gaaggcttactcaaacccctccaaatcgagctctcccggtgcgtcccctcccccgccatg
ctgcgcagctgctccacccccttcctccaagtgcgggcgcgccgacaagccgccttggat
aaactgcacgaaatcgagaagaacgtcgaaaattgggacccgaaggatttgggacagtgt
tgcaacgagttcgtgcgagaggacgtcctgatgaaagttagttcagggaaacgcttaacc
gaacgaagagttttcctcttcgacggtttactcatcttgtgtaaaccgaactcaagacga
cagagttccgttcaccaaaaccacgcagaatgtcgcttaaaggagcgttttttcatccga
aaagtcgaaatcatcgatcacttggacaccgaagagttgaagaacgcgttcgaaatcgcg
ccaagacacatgcaaccgtcggtgattttgtgtgcgaaaacagccgaagagaaaaactcg
tggatggccgacttggtgatgttgaacacgcgctcgatgttggaacgcatccttgatagt
attttgtcggatattgagcggaaacacccccttaaacttccaccgccgtctttgtacaaa
tttgcggagcccgactccaaggacaacatcatcctcgagcagcgcgagaacggaggtgtg
cccctgatcaagggcgcaacactgtataaacttgttgaaagactgacttatcatatttac
gccgatccgaaatttgtgcgcacgtttttgacgacgtatcggagtttttgttcgccgaag
gagttgctcgatttgctcattgaacgatttcaaattcccgatccgtcgctggtttatgag
caggagtgttgcgacacggataaaatgcagaaaaataatcaaagggaggattggaaaaag
tacaggaaggagtacgtgcagccggtgcagttccgagtgttgaatgtgttgaggcattgg
gttgatcatcatttttatgatttcgagcgggatcccacacttttggttaaattgagggat
tttctggatgcggtcaacgggaagagcatgaggaagtgggtggacagcgtgctcaagata
ttgcacagaaagatggaaaacgataatcagcgacacatccgcttcgccttcgacgagcct
ccgcccccgatcgaatggcacatcccttgcaccgaagaagaatacggaattctaaccctc
caccctgtcgaaatcgcacgccaactaacaattctcgaattcgatctgtaccgaatgatc
aaaccttccgaactagtcggagccgtttggacaaaaaaagacaaagaaacgacaagtccg
aatttactcaaaatgatcaaacacacaactaatgtgggccgctggttggagaaaaacatc
gtcgaggcggaaaatttcgaagaacgcgtcgcaatcctaaaccgaataatcgaaataatg
atagttttatacgaaataaataatttcaacggagtcttgtcgatcgtctcgacttgtgcc
tcggcctccgttcatcgcctcaagctgactttcgccgcgctgacgcaacagaacaagaag
gcgctggaggagtgccgagccgacgaccatttcaaaaaataccaagagaaactacgctcc
atcaacccgccctgtgtccccttcctgggcatgtacctcaccaacatcctccacatcgag
gagggcaatcccgacttcctccccaacacccaactcatcaacttcttcaagcgccgaaaa
gtcgccgaaatcaccggagaaatccaacaataccagaaccaaccgtactgtttcagcgtc
gaatcgaaaatccgccacttcctcgaaaacctcaacccgttcggcgacctctccgacacc
gaaatcagcaactacctgtacaacaagtcgatggagatcgagcccagaggccagaaacaa
gtccagaaattcccccggaaatggccacatctgagcctcaaaagtccgggcattaaatca
aaggcgaaaaccacagccacggcggtcacaaatgcgattaattccaccctgaattcgtca
aacatcaagagcgacgactcaaagagcgaagattcctcgaaatcggataacgagtttagc
gtttttgcgcccgttcagttgggcacctgccagaacagccccaccttaagcccggtctcg
ccagccacatccaacaccatcctgagctggttccagcccaaccacaaccgcagccccagt
gtgggctccatcatgtccacgacgtcgatgcgcaatccgcccccgccgcccccacaagcg
tcaaagtaccaacactatagccaaagctcgacggggggctcgaacagcccggggccgcac
agccccgcctcgcccggccccgtccaatcctacgaacctaacagtccgcgccgtccgcta
accccgcccccgcctccgcccccgctcccgccccggcggcgccgcgacagccccgaaatc
agttccccgcaattaaagaccgatcctcattggcgcgaatgctcccctcccccgctgccc
ccacgtcgcggcgatcccggttcgtcccccagctcccacattcaacactcgcatcattcc
tttaactcgttcgggggcgggaccatgccccgactcaaccccacccacatgtcgcagttg
cacatgcggcggcattcaacggtccaaccgcaggtgccgaggaggacggtccatgcgaac
gtcacgcccttagttcctcagaaccaaccagcgagtatttcgccacggtatgactcggcc
acgcctcggctgccgcccaggccggcggcccggtccgccgacatggtcacgggacccatg
ttccaatacccgagcactaccacaacttaa

DBGET integrated database retrieval system