KEGG   Tribolium castaneum (red flour beetle): 662197Help
Entry
662197            CDS       T01046                                 

Definition
similar to CG7997-PA, isoform A
Orthology
K01189  
alpha-galactosidase [EC:3.2.1.22]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Lysosome
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    662197
  Lipid metabolism
   00561 Glycerolipid metabolism
    662197
   00600 Sphingolipid metabolism
    662197
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    662197
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    662197
Enzymes [BR:tca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     662197
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG7
AA seq 411 aa AA seqDB search
MFGLLLIVVFCSRALALDNGLARTPPMGWMHWQRFRCLVDCDAYPDECISEKLFKTMADK
MASEGYLAAGYEYLIIDDCWMAKNRDAQGRLQPNATRFPSGIKALSDYVHSKGLKFGIYS
DYGTKTCAGYPGSHGHLETDAQTFAEWGVDYLKLDGCYADLDDLEPGYIQMGKFLNQTGR
PIVYSCSWPAYQEPKGVKPNYTALRETCNLWRNWDDIDDTWSNVTSILKWFSTNQDRIAE
FSGPGHWNDPDMLIIGNFGLSYEQSKAQMALWAILAAPLIMSVDLRTIEPKFRDVLLHQE
VIKINQDALGIQGRLITTINKIDIWTKPILPKGDKGALSYAIGFLSNRVDGYPYRLNVTL
AQLGINQSENYKIQDVFDPMSVEVTQSEKIFVRVKPTGVVLLTATPISAKQ
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgtttggtctccttctaatcgtcgtattttgctcaagggccttagccctagacaacggc
ctggcccgcaccccgcccatgggctggatgcactggcagaggttccggtgtctggtcgac
tgtgacgcctaccccgacgagtgcatcagcgaaaaattgttcaaaacgatggccgacaaa
atggcctcagaggggtacctggcggccggctacgagtacctcatcatcgacgactgctgg
atggccaaaaatagggacgcacagggccggctccagcccaacgcgacccggtttccgagc
gggattaaggccctgtccgactatgtgcacagtaagggcctcaaattcggaatttactcc
gactatgggaccaagacctgtgctgggtacccaggcagtcacggccacctcgaaaccgac
gcccagaccttcgcggaatggggcgtcgattacctgaaacttgatggttgttacgccgat
ttggacgaccttgaacctgggtacatccagatgggcaagtttttgaaccaaaccggacga
cccatcgtctactcctgcagctggccggcctaccaggagccaaaaggagtaaaaccgaat
tacacagctttgcgggaaacttgcaatttatggcgcaattgggacgatattgacgacact
tggtccaatgtcaccagcattttgaagtggtttagtacgaatcaggaccggatcgccgaa
ttttcgggcccggggcactggaacgaccctgatatgctcataattggcaatttcgggctc
agttatgagcaaagtaaggcccaaatggctttgtgggccattttggcggcacccttgatt
atgtcggtcgatttgaggacgattgagccgaaatttcgcgatgttttgttacaccaggaa
gtgataaaaatcaatcaggatgctttagggatccaagggcgtttaataaccactattaac
aaaattgatatttggacgaaaccgattttgccgaaaggagataaaggggcgctttcgtac
gctatcggttttttgagtaaccgagtggatggttatccctacagattgaacgtgacttta
gcccagttgggcataaatcagtccgaaaattacaaaattcaggacgtttttgaccccatg
tccgtagaggtgacccaaagcgagaaaattttcgtgagggtgaaacccacaggtgtcgtc
ctcctcacagccacgcccatctcggccaaacaataa

DBGET integrated database retrieval system