KEGG   Tribolium castaneum (red flour beetle): 662230Help
Entry
662230            CDS       T01046                                 

Definition
extracellular signal-regulated kinase 2
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Enzymes [BR:tca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     662230
Protein kinases [BR:tca01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   662230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG7
AA seq 488 aa AA seqDB search
MPHPKEKIFEIDEHISRRFDIQKRLGKGAYGIVWKAIDRKTKDVVAVKKIFDAFRNQTDA
QRTFREIMFLQSLKNHPNIVKLFSIHRAANNSDIYLGFEYMETDLHNVIKKGILKDVHKK
YVMYQLLKAVKYIHSGNVIHRDLKPSNILLDVMCRCKIADFGLARSLYQSSDSLNETDPT
LTDYVATRWYRAPEILIANRRYTKGIDMWSLGCILGEITAGKPLFPGSSTVNQVEKIMAS
IPTPSQEDISQVCVSGVGISMIKNAASSEKVPLITLLGKNACRSSISLINKLLVFNPNKR
LTAEEALEHDYVSQFHNPDEEIVLPHDIVIPFNDDVRLSVEDYRNKLYEIMSTHHVRNNK
SSCHKIKPFTTELPTRITKSYVKSVLNNKEPKSTGTQSEPKINYHAKSNNHVVTVIKSDS
KVITKQNIQFPKNLNCSRVQVHDKNTRENGRKRFSNVRSDFTTYNNYNQSHGIITQSTLM
ELKASGMR
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgccacatcccaaagaaaaaatcttcgaaatagacgaacacatctccagacggttcgac
atccagaagcgtctaggaaaaggcgcttatggtatcgtctggaaggccatagaccgtaaa
accaaggatgtcgtagccgtgaagaagattttcgacgcttttcgcaaccaaaccgacgcc
cagcgaacattccgtgagattatgttcctccaatcgctcaaaaaccacccaaatatcgtc
aagctgttcagcatccacagggcggccaataacagtgatatctatctcgggtttgagtac
atggaaactgatctccacaacgttatcaaaaagggcattttgaaggatgtccacaagaaa
tacgtaatgtatcaactcctcaaagcagtgaaatatattcattcggggaatgtgattcac
agagatctcaagccgagtaacattcttttagacgtcatgtgcagatgcaaaatagctgac
ttcggcctggcccgctctttataccaaagttcggacagtttgaacgaaaccgatccaact
ctgaccgattacgtggcaacaaggtggtaccgtgctcctgaaattttaatagcaaatcgg
aggtacaccaagggtatagacatgtggagtcttggatgcatcctgggggagataactgca
ggaaaaccgctcttccccggctcttcaacagtgaaccaagtcgagaaaatcatggctagt
ataccaacaccatcgcaagaagatattagtcaagtttgtgtgtcgggggttggtatttca
atgattaaaaacgcagcgtccagcgagaaagtacctttgattacactactagggaaaaat
gcgtgcagatcgtccatttctcttataaataagttgctagttttcaatccgaataaaaga
ctgaccgctgaagaagctctagagcatgattatgtgtcacagtttcataaccctgatgaa
gaaattgtgctaccgcatgatatcgtgatcccgtttaatgatgacgttcgtttgtcggtt
gaagattacaggaataagttgtacgagatcatgtcgacacatcacgttcgaaataataag
agttcttgtcataaaatcaaaccgttcaccactgaactaccgactaggattacaaaaagc
tacgtcaagtcggtacttaataataaagagccaaagtctacagggacacagtctgaaccc
aaaatcaactatcacgccaaaagtaacaaccatgtggtgacggtgattaagtccgactcc
aaagtgatcactaaacagaatatccagttcccgaagaatctcaactgtagtagagtacaa
gtacatgataaaaacacgagagaaaatggaaggaagaggttttcgaacgtgaggagtgac
tttaccacttataataactacaaccagtcgcatggaattataacgcagagcaccctcatg
gaactgaaggcgtctggaatgcggtag

DBGET integrated database retrieval system