KEGG   Tribolium castaneum (red flour beetle): 662234Help
Entry
662234            CDS       T01046                                 

Definition
similar to CG12311-PA
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    662234
Enzymes [BR:tca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     662234
Glycosyltransferases [BR:tca01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   662234
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG7
AA seq 694 aa AA seqDB search
MVQKEKNLQKSFWWLIFGTICVLTMTTRFYKIAEPDHVCWDETHFGKMGSWYINRTFFFD
VHPPLGKMLIGLSGYLTGYDGTFAFDKPGDKYENTSYVGMRVFCTALGATLVPMSFLAVD
EMTQSITAATFASLLILFDVGILTLTQYILLDPILLCFIMGSVLGAVKVSSPRIKEFTAT
WWFWLVFTGTMLACCISVKFVGLFVVLLVGLMTIADLWSILGDMSRPVMDTVKHLVSRGI
CLIVWPILLYITFFYIHLSVLNRSGNGDGFYSSAFQSQLIGNSLHNASMPRQVAYGAIIT
LKNHRTGGGYLHSHYHLYPENVGARQQQITTYTHKDDNNKWLVKKYNTEDTSGVTIVRSG
DLVRLEHVPTRRNLHSHKEQAPITKKHYQVTGYGENGTGDANDVWKITVIGAKDGSEVTA
VSSKLKFVHYLQSCILTTSGKQLPKWAYEQQEVSCNPNLRDPHGVWNVEENIFEKLPNVS
FEVYAPSFLERFFESHAVMFQGNAGLKPKEGEITSRPWQWPINYRGQFFSGSSYRVYLLG
NPVIWWANIIFLLVFVFVFGANAIRQQRGYIKSFSESHKEKLVACAWLFLGWLLHYVPFW
AMGRVLYFHHYFPALLFSSMITGIIIDYLLEEIPKFFTEKTGNVVYHTLVALVLSTVVYS
FYLFAPLTYGMSGPNANEPNSTMYGLKWLDTWEF
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atggtccaaaaagagaaaaatttgcaaaaaagtttctggtggttaatcttcggcactatt
tgtgttttaactatgacgacgaggttttataaaatagcagagccggaccatgtctgctgg
gatgagactcattttggcaaaatgggtagctggtatattaacagaactttcttttttgat
gtacatccaccgcttggcaagatgctaatagggctctctgggtacttaactggttatgat
ggtacttttgcatttgacaagccaggtgataaatacgaaaataccagttacgttggaatg
cgagtgttttgtacagctctgggggccactttggtgccaatgtcgtttctggcagttgat
gagatgacccagtccatcacagcagccacttttgcgtcccttttgatactttttgatgtg
ggaattctcactctaactcaatacatacttttggaccctattttattatgttttatcatg
ggttcagttttgggggctgtgaaagtgtcatcaccccgaatcaaggaatttacagcaact
tggtggttttggttggtttttacgggcactatgttggcctgttgcatttctgtaaaattt
gtggggctctttgtggtactactagtggggctcatgaccattgctgacttatggagtatt
ctaggagatatgtcgcggcctgtgatggacacagttaagcatttagtatcaagaggaatt
tgcctgattgtttggccaattctcctttacataactttcttctacatacatttgtcagta
ttaaacagaagcggaaacggcgatggcttctacagttcagcgtttcaatcccagttaata
gggaatagtcttcacaatgccagtatgccgcgccaagtggcttacggggctataatcact
ctaaaaaaccaccgaacgggtgggggttacctacactcccattaccacctgtatccggaa
aatgttggagcccgacagcaacagatcaccacttacacccacaaagacgataacaacaag
tggttggtcaaaaaatacaacactgaagacacttccggcgttacaatcgttcgcagcggc
gacttagtccgtctagaacacgtcccaactcgacgcaacctccattcccacaaagagcaa
gcccccatcactaaaaaacactaccaagtgaccggttatggcgaaaacgggaccggggac
gcgaacgacgtctggaaaatcaccgttatcggagccaaagacggcagtgaagtcactgca
gtcagcagcaaattgaaattcgtccattatttacaatcctgtattctcacaactagcgga
aaacagctcccgaaatgggcgtacgagcaacaggaggtttcatgcaaccccaatctcaga
gacccccacggagtgtggaacgtcgaggagaatattttcgaaaaattgccaaatgtgagt
ttcgaggtgtatgcgcccagttttctggagcggtttttcgagtcccacgctgtgatgttc
caaggaaacgctgggttgaaaccgaaggaaggggagatcacgtcgaggccgtggcagtgg
cctattaattacagaggccaattcttttccggttcaagctacagagtgtatttattagga
aatccggtcatttggtgggccaatatcattttcctactagttttcgtgtttgtttttggg
gccaatgccattcggcaacaacggggctacattaagtcgttttccgagtcccacaaagag
aaattggtggcgtgtgcgtggctgtttttggggtggcttttgcattatgtgccgttttgg
gcaatgggccgcgttttgtatttccaccattatttcccggctttgctttttagttcgatg
attacaggaatcatcattgattatttattggaggagataccgaaatttttcacagaaaag
acaggcaacgttgtgtatcatacattggtggcgttagttttgtccacagtggtttatagc
ttttatttattcgcgccgttaacatacggaatgagcggtcctaatgccaacgagcccaat
tctacaatgtatgggctgaaatggttggacacgtgggaattttaa

DBGET integrated database retrieval system